DLL4 Antibody

Code: CSB-PA831848
Size:
50μl
50μl100μl
US$166
Quantity:
Species Reactivity: Human,Mouse
Raised in: Rabbit
Application: ELISA,IHC
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Uniprot NO.
Target Names
DLL4
Alternative Names
AOS6 antibody; Delta 4 antibody; delta 4 precursor antibody; Delta ligand 4 antibody; delta ligand 4 precursor antibody; Delta like 4 antibody; Delta like 4 homolog antibody; Delta like 4 protein antibody; Delta like canonical Notch ligand 4 antibody; Delta like protein 4 antibody; Delta-like 4 (Drosophila) antibody; Delta-like protein 4 antibody; Delta4 antibody; DLL 4 antibody; Dll4 antibody; DLL4_HUMAN antibody; Drosophila Delta homolog 4 antibody; hdelta2 antibody; Homeobox protein DLL-4 antibody; MGC126344 antibody; Notch ligand delta 2 antibody; Notch ligand DLL4 antibody; Notch ligand DLL4 precursor antibody; XDLL-4 antibody
Raised in
Rabbit
Species Reactivity
Human,Mouse
Immunogen
Fusion protein of Human DLL4
Immunogen Species
Homo sapiens (Human)
Conjugate
Non-conjugated
Isotype
IgG
Purification Method
Antigen affinity purification
Concentration
It differs from different batches. Please contact us to confirm it.
Buffer
-20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol
Form
Liquid
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Tested Applications
ELISA,IHC
Storage
Upon receipt, store at -20°C or -80°C. Avoid repeated freeze.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time maybe differs from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Usage
For Research Use Only. Not for use in diagnostic or therapeutic procedures.
Datasheet & COA
Images
  • The image on the left is immunohistochemistry of paraffin-embedded Human breast cancer tissue using CSB-PA831848(DLL4 Antibody) at dilution 1/50, on the right is treated with fusion protein. (Original magnification: ×200)
  • The image on the left is immunohistochemistry of paraffin-embedded Human thyroid cancer tissue using CSB-PA831848(DLL4 Antibody) at dilution 1/50, on the right is treated with fusion protein. (Original magnification: ×200)

Customer Reviews and Q&A

 Customer Reviews
 Q&A
Q:

Our group is working with a developmental disease with and expected abnormal Dll4 distribution. Is the CSB-PA831848 DLL4 Antibody compatible with methanol fixation, 4% PFA fixation, or cryosections of mouse samples?

A:

The important information on the CSB-PA831848 DLL4 Antibody is below:
Species reactivity: Human, Mouse
Immunogen: C terminal 135 amino acids of human DLL4
Immunogen sequence:
AVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGLDKSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICSPRDSMYQSVCLISEERNECVIATEV

The homology between mice and humans is 95.6%, so in theory, this CSB-PA831848 DLL4 Antibody is workable with mouse samples. Because the DLL4 belongs to a membrane protein, it is compatible with 4% PFA fixation. However, we have not validated with cryosections, so we can not guarantee the test results.

Target Background

Function(From Uniprot)
Involved in the Notch signaling pathway as Notch ligand. Activates NOTCH1 and NOTCH4. Involved in angiogenesis; negatively regulates endothelial cell proliferation and migration and angiogenic sprouting. Essential for retinal progenitor proliferation. Required for suppressing rod fates in late retinal progenitors as well as for proper generation of other retinal cell types. During spinal cord neurogenesis, inhibits V2a interneuron fate.
Gene References into Functions
  1. These data indicate that DLL4 represents a new prognostic biomarker for nonsmall cell lung cancer , and DLL4 overexpression inhibits cell proliferation and metastasis in vitro. PMID:30226615
  2. Study demonstrates that DLL4 is important in regulating the tumour growth of hepatitis B virus (HBV)-associated hepatocellular carcinoma as well as the neovascularization and suppression of HBV replication. PMID:30228780
  3. this study revealed that DLL4 has pathophysiological roles on the progression of esophagus cancer cells, including migration, invasion and apoptosis, which indicated that DLL4 may be considered as a potent therapeutic target for the treatment of malignant esophageal cancer. PMID:29749499
  4. The regulation of DLL4 by the LDB2 complex provides a novel mechanism of DLL4 transcriptional control that may be exploited to develop therapeutics for aberrant vascular remodeling. PMID:28946938
  5. Data show that Delta-like 4 (DLL4) and Jagged1 (JAG1) displayed equal potency in stimulating Notch target genes in HMEC-1 dermal microvascular endothelial cells but had opposing effects on sprouting angiogenesis in vitro. PMID:28445154
  6. epigenetic silencing and TP53 mutation have an effect on the expression of DLL4 in human cancer stem disorder PMID:27542210
  7. the Notch signaling and atherosclerosis relevant markers in lesions from femoral arteries of symptomatic peripheral artery disease patients, were characterized. PMID:28472949
  8. Data suggest that Numb acts as a Notch antagonist by controlling intracellular destination and stability of the Notch ligand Delta-like 4 (DLL4) through a post-endocytic sorting process; Numb negatively controls DLL4 plasma membrane recycling through well-documented recycling regulator protein AP1. PMID:29042443
  9. Results show that DLL4 is involved in SYNJ2BP-induced hepatocellular carcinoma (HCC) development though activating its pathway. PMID:27440153
  10. Positive Jagged1 and DLL4 expression is closely correlated with severe clinicopathological characteristics and poor prognosis in patients with gallbladder cancers. PMID:27174628
  11. We show that GIT1, which also contains an ANK domain, inhibits the Notch1-Dll4 signaling pathway by competing with Notch1 ANK domain for binding to RBP-J in stalk cells PMID:27926858
  12. Results provide evidence that DLL4 is associated with gastric cancer stem/progenitor cells (GCSPCs), and its expression impacts CSPC stemness characteristics associated with the Notch-1 pathway including self-renewal, differentiation, proliferation, and tumor formation. PMID:27891816
  13. The authors present novel structures of human ligands Jagged2 and Delta-like4 and human Notch2, together with functional assays, which suggest that ligand-mediated coupling of membrane recognition and Notch binding is likely to be critical in establishing the optimal context for Notch signalling. PMID:28572448
  14. Overexpression of DLL4 could significantly attenuate the cytotoxic effects of docetaxel in MCF-7 cells by increasing Bcl-2 expression, while decreasing Bax expression, apoptosis rate and DNA damage PMID:27334972
  15. In gastric epithelial cells co-cultured with Helicobacter pylori, the expression level of the ligand DLL4 was found to be significantly increased. PMID:27073072
  16. Low DLL4 abundance in tumour cells may predict the benefit from adjuvant gemcitabine therapy after PDAC resection. PMID:27755532
  17. Angiogenesis in Infantile haemangioma (IH) appears to be controlled by DLL4 within the endothelium in a VEGF-A isoform-dependent manner, and in perivascular cells in a VEGF-independent manner. The contribution of VEGF-A isoforms to disease progression also indicates that IH may be associated with altered splicing. PMID:26957058
  18. Dll4 modulates liver inflammatory response by down-regulating chemokine expression PMID:27171900
  19. Positive Jagged1 and DLL4 expression is closely correlated with severe clinicopathological characteristics and poor prognosis in patients with pancreatic ductal carcinoma. PMID:27919854
  20. Data show that the IgA/delta-like protein 4 (Delta-4)/Notch receptor (Notch) axis is not observed in IgG-dendritic cells (DCs). PMID:27117596
  21. Data suggest that the vascular DLL4-Notch4 signaling and VEGF signaling complementing each other plays an important role in the progression of tumor angiogenesis in primary glioblastoma. PMID:26472724
  22. our data indicate that high DLL4 expression predicts pelvic lymph node metastasis and poor survival in cervical cancer. Therefore, DLL4 may be a potential clinical diagnostic marker for patients with early-stage cervical cancer. PMID:26546434
  23. Cyclic AMP Response Element Binding Protein Mediates Pathological Retinal Neovascularization via Modulating DLL4-NOTCH1 Signaling PMID:26870802
  24. DLL4 and JAG1 may have opposing effects on tumor angiogenesis in glioblastoma. PMID:26546995
  25. Expression of D114 in the vessels of dermal microvasculature was shown to increase from 20 weeks of gestation to 20 years. PMID:27487663
  26. Data indicate the role for altered forkhead box C2 (FoxC2)-Delta-like ligand 4 (Dll4)signaling in structural alterations of saphenous veins in patients with varicose veins. PMID:26808710
  27. Antagonism of the DLL4-Notch signaling pathway might provide a potential therapeutic approach for breast cancer treatment by preventing angiogenesis. PMID:26739060
  28. Activation of Dll4/Notch signaling led to increased expression of ephrin-B2 and subsequent inhibition of endothelial progenitor cells activity. PMID:26212082
  29. DLL4 is a unique functional molecule of human circulating dendritic cells critical for directing Th1 and Th17 differentiation PMID:26712946
  30. The expression of DLL4 was positively correlated with CD105-labeled MVD. PMID:25986715
  31. The detection of Notch1 and Delta-like 4 expression in peripheral blood lymphocytes of renal transplant recipients can serve as a positive indicator for evaluating the diagnosis and treatment efficacy of the AR reaction. PMID:26070613
  32. Among all the Notch ligands, Delta-like4 (Dll4) is specifically involved in angiogenesis. hD4R could suppress angiogenesis in vitro as manifested by network formation assay and sprouting assay. PMID:25833803
  33. DLL4 and VEGFA expression was closely related to tumour diameter, clinical stage, histological grade and lymph node metastasis. PMID:26111775
  34. DLL4/Notch1 and BMP9 interdependent signaling induces endothelial cell quiescence via P27KIP1/thrombospondin pathway. PMID:26471266
  35. Overexpression of DLL4 is associated with thyroid tumor invasion and metastasis. PMID:26241546
  36. Macrophage Dll4 promotes lesion development in vein grafts via macrophage activation and crosstalk between macrophages and smooth muscle cells. PMID:26404485
  37. Heterozygous Loss-of-Function Mutations in DLL4 Cause Adams-Oliver Syndrome. PMID:26299364
  38. IL-23 could promote migration of human ESCC cells by activating DLL4/Notch1 signaling pathway PMID:26062426
  39. expression of VEGF and Dll4/Notch pathway molecules in ovarian cancer PMID:24949865
  40. Dormant Dbf4 mRNA in immature GV oocytes is recruited by cytoplasmic polyadenylation during oocyte maturation and is dependent on MPF activity via its cytoplasmic polyadenylation element (CPE) PMID:25348865
  41. High DLL4 expression is associated with T acute lymphoblastic leukemia. PMID:25355291
  42. Inhibition of ADAM10/17 or knockdown of DLL4 reduced the proangiogenic effects of fibulin-3 in culture PMID:25139440
  43. Dll4 expression is up-regulated in clear cell renal cell carcinoma patients, and predicts poor prognosis. PMID:24966922
  44. Dengue virus up-regulates expression of notch ligands Dll1 and Dll4 through interferon-beta signalling pathway. PMID:25041739
  45. Our data suggest that renal cell carcinoma progression is caused in part by activated DLL4/Notch signaling, interaction of endothelium and cells PMID:24931473
  46. these results suggest that high expression of DLL4 is associated with axillary lymph node metastasis and a poor prognosis in breast cancer, suggesting its value as a diagnostic marker for breast cancer. PMID:25260720
  47. These findings indicate a potential role for the Notch-1-Dll4 signaling pathway in foreign body-induced granulomatous reactions PMID:24394305
  48. High expression of DLL4 is associated with metastasis in breast cancer. PMID:24696220
  49. findings suggest that ADAM10/Dll4 signaling is a major signaling pathway in ECs driving inflammatory events involved in inflammation and immune cell recruitment PMID:25130545
  50. Dll4-containing exosomes increase endothelial cell motility while suppressing their proliferation. PMID:24504253

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed in vascular endothelium.
Database Links

HGNC: 2910

UNIGENE: Hs.511076

KEGG: hsa:54567

STRING: 9606.ENSP00000249749

OMIM: 605185

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products