Abbreviation
Recombinant Cynomolgus monkey TNFRSF1A protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TNFRSF1A at 2 μg/mL can bind Human TNF(CSB-MP023955HUk7-B). The EC50 is 10.33-12.16 ng/mL.
Alternative Names
Tumor necrosis factor receptor 1 ; Tumor necrosis factor receptor type I; p55 ; p60; TNFRSF1A
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
30-211aa
Target Protein Sequence
LVPPLRDREKRDSVCPQGKYIHPQNNSVCCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRYYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKTLECTKLCLPQTENVKGTEDSGTT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TNFRSF1A at 2 μg/ml can bind Human TNF(CSB-MP023955HUk7-B). The EC50 is 10.33-12.16 ng/mL.
Description
TNFR1 mediates the pleiotropic effects of TNF-α in inflammation, apoptosis, and immune regulation, making it a critical target in cancer immunology and therapeutic antibody development. This recombinant cynomolgus monkey TNFRSF1A, spanning the extracellular ligand-binding domain (residues 30–211), demonstrates quantifiable binding to human TNF with an EC50 of 10.33–12.16 ng/mL in functional ELISA, confirming that mammalian expression preserves the native conformational epitopes required for high-affinity ligand recognition. The validated activity supports use in ligand-binding assays, competitive inhibition screens for TNF-blocking biologics, and therapeutic antibody epitope mapping where cross-reactivity between human and cynomolgus orthologs must be characterized for preclinical safety studies. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for SPR affinity characterization, biolayer interferometry kinetics, and antibody screening workflows in oncology drug discovery.
