Abbreviation
Recombinant Cynomolgus monkey LTBR protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus LTBR at 2 μg/mL can bind Biotinylated human TNFSF14 (CSB-MP023991HUj7-B). The EC50 is 4.316-4.875 ng/mL.
Alternative Names
Lymphotoxin beta receptor; LTBR
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
28-229aa
Target Protein Sequence
SQPQVVRKGPVPPYGSENQTCRDQEKEYYEPRHRICCSRCPPGTYVSAKCSRSRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCEDQGLVEAAPGTAQSDTTCRNPSESLPPEMSGT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus LTBR at 2 μg/ml can bind Biotinylated human TNFSF14 (CSB-MP023991HUj7-B). The EC50 is 4.316-4.875 ng/mL.
Description
Lymphotoxin beta receptor mediates critical signals in lymphoid organogenesis and immune homeostasis, making its extracellular domain a key target for dissecting TNF superfamily interactions in primate models. This mammalian-expressed construct spanning residues 28–229 demonstrates quantifiable binding to biotinylated human TNFSF14 with an EC50 of 4.316–4.875 ng/mL in functional ELISA, providing a validated reagent for ligand-receptor interaction studies, competitive inhibition assays, and blocking antibody screening in cynomolgus macaque research. The C-terminal hFc1 tag facilitates immobilization in surface plasmon resonance and biolayer interferometry platforms, supporting affinity characterization and therapeutic antibody epitope mapping with direct relevance to translational primate pharmacology. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in functional binding assays and antibody validation workflows.