Abbreviation
Recombinant Human ZG16B protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody (CSB-RA836195MA1HU), the EC50 is 24.13-46.04 ng/mL.
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
53-208aa
Target Protein Sequence
GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/ml can bind Anti-ZG16B recombinant antibody (CSB-RA836195MA1HU), the EC50 is 24.13-46.04 ng/mL.
-
The purity of ZG16B was greater than 95% as determined by SEC-HPLC
Description
ZG16B is a secreted lectin implicated in pancreatic adenocarcinoma progression, making it a valuable target for cancer biology research focused on tumor microenvironment signaling. This recombinant human ZG16B, spanning residues 53–208 of the mature protein, is produced in a mammalian expression system to support proper folding and post-translational modifications, and carries a C-terminal 10xHis tag for convenient purification or surface immobilization. Functional ELISA validation confirms robust binding activity, with immobilized ZG16B at 2 μg/mL engaging an anti-ZG16B recombinant antibody at an EC50 of 24.13–46.04 ng/mL, providing a suitable basis for antibody characterization, sandwich ELISA development, and protein–protein interaction screening. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for use as a reliable standard in quantitative binding assays and as an immunogen in antibody development workflows.
