Home
Product
Protein
Active Protein
Other
Recombinant Human Pancreatic adenocarcinoma up-regulated factor (ZG16B) (Active)

Recombinant Human Pancreatic adenocarcinoma up-regulated factor (ZG16B) (Active)

CSB-MP836195HU

Rate （N/A）
Review （0）

Size:

20ug100ug1mg

US$138

Quantity:

Express system: Mammalian cell

Species: Homo sapiens (Human)

Tag Info: C-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody (CSB-RA836195MA1HU), the EC₅₀ is 24.13-46.04 ng/mL.

Target Names

ZG16B

Uniprot NO.

Q96DA0

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

53-208aa

Target Protein Sequence

GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR

Mol. Weight

20.0 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 10xHis-tagged

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8

Storage

Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Shelf Life

The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/ml can bind Anti-ZG16B recombinant antibody (CSB-RA836195MA1HU), the EC₅₀ is 24.13-46.04 ng/mL.
The purity of ZG16B was greater than 95% as determined by SEC-HPLC

Description

This Human ZG16B recombinant protein was produced in mammalian cell, where the gene sequence encoding Human ZG16B (53-208aa) was expressed with the C-terminal 10xHis tag. The purity of this ZG16B protein was greater than 95% by SDS-PAGE. The activity was validated in functional ELISA.

ZG16B was first found to be highly expressed in pancreatic cancer and plays an important role in carcinogenesis, and was named as pancreatic cancer-related up-regulator PAUF. The latest research results show that ZG16B plays its role as an oncogene by up-regulating the expression and transcriptional activity of β-catenin in pancreatic cancer. At the same time, other studies have also found that ZG16B is not only highly expressed in pancreatic cancer, but also in colon cancer. It is also highly expressed in ovarian cancer, gastric cancer and other cancer tissues. Furthermore, ZG16B plays an important role in cancer progression such as cell proliferation, adhesion, migration, and invasion. However, in colon cancer, whether ZG16B plays a role in cancer by upregulating the expression and transcriptional activity of β-catenin and activating the Wnt/β-catenin signaling pathway is still unknown. As a novel activator of human endothelial cells, ZG16B has similar effects to vascular endothelial growth factor (VEGF), which can promote angiogenesis and increase vascular permeability in vitro and in vivo.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Gene References into Functions

we conclude that the PAUF is a powerful and multifunctional promoter of tumor growth through increase and functional activation of myeloid-derived suppressor cells PMID:27322081
Mouse DCPP1 is a multifunctional promoter of tumor growth through functional activation of pancreatic cancer cells, suggesting it to be an ortholog of human PAUF. PMID:28988106
Our results suggest that PAUF has tumour-promoting functions in oral squamous cell carcinoma PMID:27706833
High PAUF expression is associated with resistance to gemcitabine in pancreatic cancer. PMID:26684804
PAUF mediated dendritic cell activation and immune stimulation are dependent on TLR4 PMID:26336989
constitutive suppression of PAUF sensitized Bxpc3 pancreatic cancer cells to oncolytic parvovirus H-1 infection PMID:25727013
PAUF rs12373A>C polymorphisms are associated with colorectal cancer. PMID:25079514
PAUF-siRNA inhibited the proliferation of colorectal cancer cells, promoted their apoptosis and induced G0/G1 cell cycle arrest. At the same time, PAUF-siRNA inhibited the invasion, adhesion and migration of the tumor cells. PMID:23677445
new possibilities for PAUF's role in the pathogenesis of angiogenesis-dependent diseases PMID:22907431
activation of SIRT1 inhibited the proliferation of pancreatic cancer -PAUF cells by down-regulation of cyclin-D1, a target molecule of beta-catenin. PMID:22640743
PAUF-mediated FAK activation plays an important role in pancreatic cancer progression. PMID:21464589
PAUF can up-regulate and stabilize beta-catenin via a novel pattern of phosphorylation, thereby contributing to the rapid proliferation of pancreatic cancer cells. PMID:21196815
Data demonstrate that the host salivary protein CSP-1 (HRPE773 GenBank AAQ89380.1) binds to S. mutans cells and may influence the initial colonization of this pathogenic bacterium onto the tooth surface. PMID:20858015
the sugar-binding site and the adjacent basic patch of ZG16p and ZG16b cooperatively form a functional glycosaminoglycan-binding site. PMID:21110947
PAUF is a mammalian lectin normally found in plant lectins. PAUF induces extracellular signal-regulated kinase phosphorylation and activates the IKK-b-mediated TPL2/MEK/ERK signaling pathway through TLR2. PMID:20802527
Findings indicate that PAUF enhances the metastatic potential of pancreatic cancer cells, at least in part, by upregulating CXCR4 expression. PMID:19784070
Bioinformatic analysis identified a putative human CSP-1/Dcpp ortholog, HRPE773, expressed predominantly in human salivary tissue, that shows 31% amino acid identity and 45% amino acid similarity to the mouse Dcpp query sequence. PMID:16954406
pancreatic adenocarcinoma up-regulated factor was secreted into the culture medium of pancreatic adenocarcinoma up-regulated factor-overexpressing Chinese hamster ovary cells, had an apparent molecular mass of approximately 25 kDa, and was N-glycosylated PMID:19302292