Abbreviation
Recombinant Human VEGFA protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤10 EU/mg by the LAL method
Activity
Measured in a cell proliferation assay using HUVEC human umbilic vein endothelial cells. The ED50 for this effect is 0.2-10 ng/mL.
Target Names
VEGF165(His Tag)
Alternative Names
Vascular Endothelial Growth Factor Isoform 165; VEGF165
Species
Homo sapiens (Human)
Expression Region
27-191aa
Target Protein Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein of Isoform VEGF165
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
VEGF165, the predominant pro-angiogenic isoform in human physiology, drives endothelial cell proliferation and migration through high-affinity binding to VEGFR-2, making quantitative control of receptor activation essential in vascular biology experiments. This mammalian-expressed protein, spanning the complete mature sequence (aa 27–191), demonstrates dose-dependent mitogenic activity in HUVEC proliferation assays with an ED50 of 0.2–10 ng/mL, providing a validated concentration range for angiogenesis models, wound healing studies, and stem cell differentiation protocols requiring precise VEGFR engagement. The mammalian expression system preserves native glycosylation patterns critical for receptor binding kinetics, supporting its use in surface plasmon resonance experiments, receptor-ligand competition assays, and antibody characterization workflows where post-translational fidelity directly impacts binding affinity measurements. Purity exceeding 95% by SDS-PAGE and endotoxin levels ≤10 EU/mg satisfy the quality thresholds commonly required for cell-based functional assays and in vivo tumor vascularization models.
