Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active)

In Stock
Code: CSB-MP023984HU1
Size:
20ug
20ug100ug1mg
US$138
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human TNFRSF9 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized TNFRSF9 at 2 μg/mL can bind TNFSF9(CSB-MP023997HU1), the EC50 is 1.011-2.429 ng/mL.
Target Names
TNFRSF9
Uniprot NO.
Research Area
Cancer
Alternative Names
(4-1BB ligand receptor) (CDw137) (T-cell antigen 4-1BB homolog) (T-cell antigen ILA) (CD antigen CD137)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
24-186aa
Target Protein Sequence
LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.1 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized TNFRSF9 at 2 μg/ml can bind TNFSF9(CSB-MP023997HU1), the EC50 is 1.011-2.429 ng/mL.
Description

TNFRSF9 (4-1BB/CD137) is a key costimulatory receptor in immuno-oncology whose engagement with its ligand TNFSF9 amplifies T-cell activation and antitumor immunity. This recombinant construct spans the extracellular ligand-binding domain (aa 24–186), expressed in mammalian cells with a C-terminal 10×His tag to preserve native glycosylation and conformational integrity critical for receptor-ligand interaction studies. Functional ELISA confirms robust binding to TNFSF9 with an EC50 of 1.011–2.429 ng/mL, supporting use in ligand-binding assays, competitive inhibition studies, blocking antibody screening, and therapeutic antibody epitope mapping relevant to immune checkpoint drug discovery. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the quality thresholds commonly required for SPR/BLI affinity characterization and cell-based functional assays in cancer immunology research.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Antigen

Review: After receiving the product, we conducted ELISA experiments to verify the good binding activity between TNFRSF9 and the ligand TNFSF9, and the EC50 was 2.671-3.702 ng/mL, which can be used for subsequent immune and antibody screening experiments. Compared to other manufacturers, it has high activity, favorable prices, short delivery time, and high cost-effectiveness!

By Anonymous

Target Background

Function(From Uniprot)
Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.
Gene References into Functions
  1. 3 SNPs (rs161827, rs161818, and rs161810) of the CD137 gene and their association with ischemic stroke were studied in a northern Chinese Han population. rs161827 was significantly different between patients with and without diabetes and the controls. rs161818 and rs161810 differed significantly between patients without diabetes and the controls. All 3 were statistically significant in the combination stroke group. PMID:28755037
  2. Herein, we present LOAd703, a designed adenovirus armed with trimerized CD40L and 4-1BBL that activates the CD40 and 4-1BB pathways, respectively PMID:28536305
  3. Tonic 4-1BB costimulation in chimeric antigen receptors impedes T cell survival and is vector-dependent. PMID:28978471
  4. Cetuximab-mediated NK-cell expression of CD137 on tumor-infiltrating lymphocytes is dependent on FcgammaRIIIa polymorphism. In neoadjuvant cetuximab-treated patients with head and neck cancer, upregulation of CD137 by intratumoral, cetuximab-activated NK cells correlated with FcgammaRIIIa V/F polymorphism and predicted clinical response. PMID:27496866
  5. In this study we systematically evaluated a series of CAR constructs targeting glypican-3 (GPC3), which is selectively expressed on several solid tumors. We compared GPC3-specific CARs that encoded CD3zeta (Gz) alone or with costimulatory domains derived from CD28 (G28z), 4-1BB (GBBz), or CD28 and 4-1BB (G28BBz). PMID:27530312
  6. 4-1BB and 4-1BBL qualify as markers for prediction of patients' course and represent a valuable screening target for patients with acute myeloid leukemia at initial diagnosis. PMID:27388616
  7. the role of CD137-CRDI (cysteine rich domain I) in the binding of CD137-CD137L was further investigated. PMID:27430526
  8. Egr2-driven cell surface proteins LAG-3 and 4-1BB can identify dysfunctional tumor antigen-specific CD8(+) TIL. PMID:28115575
  9. Findings indicate that CD137 antigen is a useful marker that can be used for identifying Mycobacterium tuberculosis (Mtb)-reactive CD4(+) T cells (Mtb-reactive CD4(+) T cells) by flow cytometry. PMID:28218958
  10. Anti-4-1BB single chain variable fragments enhanced surface CD69 expression and interleukin-2 production in stimulated CCRF-CEM cells which confirmed the agonistic effect of the selected single chain variable fragments. The data from this study have provided a rationale for further experiments involving the biological functions of anti-4-1BB single chain variable fragments in future studies. PMID:28347235
  11. Studies suggest that adoptive T cell therapy and CD137 antigen offer much opportunity to raise the efficacy of current cancer immunotherapies. PMID:26970765
  12. in complex with T cell receptor, promotes memory T cells, cell respiration, fatty acid oxidation and mitochondrial biogenesis PMID:26885860
  13. These studies provide the first direct evidence that ligation of tumour necrosis factor superfamily members and their cognate receptors is important for the control of viral lytic replication. PMID:26467721
  14. Our findings provide a novel, TNFRSF9-positive, reactive astrocytic phenotype in human gliomas PMID:24606203
  15. Human genetic evidence for involvement of CD137 in atherosclerosis PMID:25032953
  16. As a result of becoming activated, transferred human T lymphocytes express the inducible surface antigens hPD-1 and hCD137 on their plasma membrane. PMID:26113085
  17. Our results provide biological explanations for the antitumor effects of CD19 CARs and for the observations that CD19 CAR T cells incorporating the 4-1BB costimulatory domain are more persistent than those incorporating CD28 in clinical trials. PMID:25939063
  18. upregulation of CD137 expression through LMP1 by EBV promotes cell survival in T or NK cells PMID:25409517
  19. Based on CD137 or CD154 expression. PMID:25367298
  20. High expression of CD137 is associated with type 1 diabetes. PMID:24797972
  21. DENV C disrupts Daxx and NF-kappaB interaction to induce CD137-mediated apoptosis during DENV infection PMID:25019989
  22. action of agonist anti-4-1BB in suppressing autoimmune and allergic inflammation was completely dependent on Galectin-9 (Gal-9). Gal-9 directly bound to 4-1BB, in a site distinct from the binding site of antibodies and the natural ligand of 4-1BB PMID:24958847
  23. A role for the TNFR-family member CD137 in the immunobiology of human cancer where it is preferentially expressed on tumor-reactive subset of tumor-infiltrating lymphocytes. PMID:24045181
  24. monocytes interact with iNKT cells to increase expression of 4-1BBL and 4-1BB, and in conjunction with this pathway, maintain their numbers at baseline. PMID:24639347
  25. findings show that immunohistochemistry for CD137L is capable of reliably distinguishing small B-cell lymphomas from reactive lymphoid aggregates PMID:24746207
  26. Dengue virus induces CD137 signaling to enhance apoptosis by increasing TNF-alpha production via activation of p38 MAPK. PMID:23557259
  27. this is the first study to indicate that this member of the TNF superfamily, CD137, is modulated by SAHA treatment in breast cancer cells PMID:22797667
  28. The CD137 multi-parameter flow cytometry fast assay allows for phenotypic and functional determination of alloreactive precursor frequencies of both CD4+ and CD8+ T cells with high sensitivity and specificity. PMID:23750604
  29. Co-stimulation through 4-1BB/CD137 improves the expansion and function of CD8(+) melanoma tumor-infiltrating lymphocytes for adoptive T-cell therapy. PMID:23560068
  30. Taken together, these data provide evidence that the 4-1BB signal is an important regulator of gammadelta T cells PMID:23640752
  31. the mechanisms that account for the effect of CD137 signaling on TNF-alpha production were based on a decrease of TNF-alpha production by antigen presenting cell (APC) and, perhaps, on the increase in APC apoptosis. PMID:23437083
  32. Our results reveal a new regulatory mechanism for CD137L expression that mediates immune escape by HRS cells, and they identify CD137 as a candidate target for immunotherapy of Hodgkin PMID:23204227
  33. Head and neck cancer patients have decreased levels of alternative co-stimulatory receptors OX40 and 4-1BB. PMID:22204816
  34. 4-1BB (CD137), together with CD103, marks mesenteric lymph node dendritic cells (DC) with the highest level of retinal dehydrogenase (RALDH) activity, and ligation of 4-1BB maintains RALDH expression in these gut DC. PMID:22896640
  35. CD137 protein is expressed by a select group of hematolymphoid tumors, including classical Hodgkin lymphoma, T-cell and NK/T-cell lymphomas, and follicular dendritic cells neoplasms. PMID:22901750
  36. treatment with CD137 agonistic antibody induces CCL21 expression and DC accumulation close to lymphatic vessels. Collectively, our results demonstrate that the inflammatory function of lymphatic vessels can be regulated by CD137. PMID:22593548
  37. CD137:CD137L interactions regulate the innate and adaptive immune response of the host against M. tuberculosis PMID:21747409
  38. significantly positive correlation between CD137 expression and complex coronary stenosis morphology PMID:21396356
  39. Data indicate that 4-1BBL mediates NK-cell immunosubversion in CLL, and thus might contribute to the reportedly compromised efficacy of Rituximab to induce NK-cell reactivity in the disease. PMID:22144129
  40. CD137 activity is directly proportional to colorectal cancer stage. Surgical resection of the tumor results in increased CD134 and CD137 expression PMID:22343199
  41. We show that the inflammatory and cytotoxic function of CD4(+)CD28(null) T cells can be inhibited by blocking OX40 and 4-1BB costimulatory receptors. PMID:22282196
  42. The sCD137 levels correlate with the probability of complications and lethality. The association of sCD137, a product of activated T cells, with the severity of acute pancreatitis suggests that T cells contribute to the pathogenesis of acute pancreatitis. PMID:21963611
  43. CD137 has a role in breast cancer and its specific antibody can be used to enhance trastuzumab efficacy PMID:22326955
  44. conditioned medium from Lewis Lung Carcinoma cells caused significant upregulation of 4-1BB in mast cells PMID:22343053
  45. Data indicate that ex4-1BBL augments 4-1BB expression not only on the primed T cell, but also on DC. PMID:21745658
  46. The measurement of a single gene expressed by tumor cells (LMO2) and a single gene expressed by the immune microenvironment (TNFRSF9) powerfully predicts overall survival in patients with diffuse large B-cell lymphoma. PMID:21670469
  47. This work is the first to demonstrate the contribution of CD137 signaling to DENV-mediated apoptosis. PMID:21669186
  48. CD137 ligand can also be expressed as a transmembrane protein on the cell surface and transmit signals into the cells on which it is expressed (reverse signaling). PMID:20643812
  49. Results suggest with a two-step model of M cell differentiation, with initial CD137-independent commitment to the M cell lineage followed by CD137-CD137L interaction of M cells with CD137-activated B cells or dendritic cells for functional maturation. PMID:20616340
  50. Data support a role for CD137 in the recruitment of monocytes to inflammatory tissues. PMID:20347151

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed on the surface of activated T-cells.
Database Links

HGNC: 11924

UNIGENE: Hs.738942

KEGG: hsa:3604

STRING: 9606.ENSP00000366729

OMIM: 602250

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products