Abbreviation
Recombinant Human TNFRSF18 protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18 (CSB-MP891791HU), the EC50 is 2.565 to 2.940 ng/ml.②Human TNFRSF18 protein hFc tag (CSB-MP896537HU) captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag (CSB-MP891791HU) with an affinity constant of 38.5 nM as detected by LSPR Assay.
Alternative Names
(CD357)(AITR)(GITR)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
26-162aa
Target Protein Sequence
QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18 (CSB-MP891791HU), the EC50 is 2.565 to 2.940 ng/ml.
-
Activity
Human TNFRSF18 protein hFc tag (CSB-MP896537HU) captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag (CSB-MP891791HU) with an affinity constant of 38.5 nM as detected by LSPR Assay.
Description
TNFRSF18 (GITR) plays a critical role in T-cell co-stimulation and immune regulation, making precise characterization of its interaction with GITRL essential for immunotherapy research. This recombinant human TNFRSF18 encompasses the extracellular ligand-binding domain (aa 26–162) produced in mammalian cells to preserve native glycosylation and disulfide-mediated folding, with a C-terminal hFc1 tag facilitating oriented capture in binding assays. Validated activity demonstrates an EC50 of 2.565–2.940 ng/ml for TNFSF18 binding by functional ELISA and a KD of 38.5 nM by LSPR, providing a suitable basis for receptor-ligand interaction studies, competitive blocking antibody screening, therapeutic antibody epitope mapping, and affinity characterization by SPR or BLI. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for use as a positive control in quantitative binding assays and small-molecule inhibitor screening campaigns.
