Abbreviation
Recombinant Human TNFRSF17 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Anti-TNFRSF17 recombinant antibody (CSB-RA023974MA1HU). The EC50 is 5.652-7.215 ng/mL.
②Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Anti-TNFRSF17 recombinant antibody (CSB-RA023974MA3HU). The EC50 is 2.296-2.754ng/mL.
③Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Anti-TNFRSF17 recombinant antibody (CSB-RA023974MA4HU). The EC50 is 14.97-19.19 ng/mL.
④Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Human TNFSF13 protein (CSB-MP023989HU). The EC50 is 4.217-5.674 ng/mL.
⑤Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Human TNFSF13B protein (CSB-MP897523HU1). The EC50 is 4.346-5.534 ng/mL.
Alternative Names
B-cell maturation protein (CD_antigen: CD269)(BCM) (BCMA)
Species
Homo sapiens (Human)
Target Protein Sequence
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/ml can bind Anti-TNFRSF17 recombinant antibody (CSB-RA023974MA1HU). The EC50 is 5.652-7.215 ng/mL.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/ml can bind Anti-TNFRSF17 recombinant antibody (CSB-RA023974MA3HU). The EC50 is 2.296-2.754ng/mL.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/ml can bind Anti-TNFRSF17 recombinant antibody (CSB-RA023974MA4HU). The EC50 is 14.97-19.19 ng/mL.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/ml can bind Human TNFSF13 protein (CSB-MP023989HU). The EC50 is 4.217-5.674 ng/mL.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/ml can bind Human TNFSF13B protein (CSB-MP897523HU1). The EC50 is 4.346-5.534 ng/mL.
Description
BCMA serves as a critical survival receptor on plasma cells and multiple myeloma cells, making it a high-priority target for CAR-T and antibody-drug conjugate therapies in hematologic malignancies. This mammalian-expressed fragment spanning residues 1–54 captures the extracellular ligand-binding domain and demonstrates robust binding to its natural ligands APRIL (TNFSF13) and BAFF (TNFSF13B) with EC50 values of 4.2–5.7 ng/mL and 4.3–5.5 ng/mL respectively, confirming native-like conformational integrity essential for physiologically relevant interaction studies. The protein also binds three distinct anti-BCMA recombinant antibodies with EC50 values ranging from 2.3 to 19.2 ng/mL, providing quantitative benchmarks for therapeutic antibody epitope mapping, competitive inhibition assays, and blocking antibody screening in CAR-T development workflows. With purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg, this reagent supports high-sensitivity binding assays including ELISA, surface plasmon resonance, and bio-layer interferometry for affinity characterization and drug discovery applications targeting the BCMA pathway.
