Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C), partial (Active)

CSB-MP853495HU1
Size:
20ug
20ug100ug1mg
US$116
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal hFc1-Flag-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.
Promotion

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B (CSB-MP897523HU1) at 2 μg/ml can bind TNFRSF13C, the EC50 is 9.943-15.72 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 μg/ml can bind Biotinylated human TNFSF13B (CSB-MP897523HU1-B), the EC50 is 0.2699-0.5613 ng/ml.
Target Names
TNFRSF13C
Uniprot NO.
Alternative Names
(B-cell-activating factor receptor)(BAFF receptor)(BAFF-R)(BLyS receptor 3)(CD268)(BAFFR)(BR3)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
7-71aa
Target Protein Sequence
SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA
Mol. Weight
36.4 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-Flag-tagged
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B (CSB-MP897523HU1) at 2 μg/ml can bind TNFRSF13C, the EC50 is 9.943-15.72 ng/ml.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 μg/ml can bind Biotinylated human TNFSF13B (CSB-MP897523HU1-B), the EC50 is 0.2699-0.5613 ng/ml.
Description

The recombinant human TNFRSF13C protein is an active protein generated in mammalian cells. Its production is achieved by introducing a plasmid construct containing the gene fragment encoding the 7-71aa of the human TNFRSF13C into the mammalian cell expression system. This TNFRSF13C protein is tagged with a hFc-Flag at the C-terminus. SDS-PAGE analysis indicates its purity greater than 95%, while LAL testing confirms endotoxin levels below 1.0 EU/μg. The biological activity of the TNFRSF13C protein is validated via ELISA, showing specific binding toTNFSF13B (CSB-MP897523HU1) and biotinylated human TNFSF13B (CSB-MP897523HU1-B) with an EC50 of 9.943-15.72 ng/ml and 0.2699-0.5613 ng/ml, respectively.

Human TNFRSF13C (BAFF-R) is a vital receptor in the immune system that regulates B-cell survival and function through its interaction with BAFF. This receptor is primarily expressed on B cells, where it plays a pivotal role in their maturation and activation processes [1][2]. The interaction between BAFF and TNFRSF13C is crucial for maintaining the balance of B-cell populations, as dysregulation can lead to the survival of autoreactive B cells, contributing to autoimmune pathology [3][4].

Research has shown that variations in the TNFRSF13C gene can influence susceptibility to autoimmune diseases and other immune disorders. Specific genetic variants of TNFRSF13C have been associated with common variable immunodeficiency (CVID) and autoimmune lymphoproliferative syndrome-like conditions, highlighting its importance in immune regulation [1][5].

In the context of cancer, TNFRSF13C has been identified as a potential therapeutic target, particularly in B-cell malignancies. Its expression is often upregulated in various types of lymphomas, making it a promising candidate for targeted therapies aimed at modulating B-cell activity [2][6].

References:
[1] R. Russo, I. Andolfo, V. Lasorsa, S. Cantalupo, R. Marra, G. Frisso, et al. The tnfrsf13c h159y variant is associated with severe covid-19: a retrospective study of 500 patients from southern italy, Genes, vol. 12, no. 6, p. 881, 2021. https://doi.org/10.3390/genes12060881
[2] Z. Dong, J. Song, E. Thieme, A. Anderson, E. Oh, W. Cheng, et al. Generation of a humanized afucosylated baff-r antibody with broad activity against human b-cell malignancies, Blood Advances, vol. 7, no. 6, p. 918-932, 2023. https://doi.org/10.1182/bloodadvances.2022008560
[3] J. Frostegård, C. Hellström, P. Nilsson, A. Frostegård, & S. Ajeganova. Autoantibody profiling reveals four protein candidate autoantigens associated with systemic lupus erythematosus, Lupus, vol. 27, no. 10, p. 1670-1678, 2018. https://doi.org/10.1177/0961203318788153
[4] M. Morissette, Y. Gao, P. Shen, D. Thayaparan, J. Bérubé, P. Paré, et al. Role of baff in pulmonary autoantibody responses induced by chronic cigarette smoke exposure in mice, Physiological Reports, vol. 4, no. 24, 2016. https://doi.org/10.14814/phy2.13057
[5] A. Richard, J. Peters, J. Lee, G. Vahedi, A. Schäffer, R. Siegel, et al. Targeted genomic analysis reveals widespread autoimmune disease association with regulatory variants in the tnf superfamily cytokine signalling network, Genome Medicine, vol. 8, no. 1, 2016. https://doi.org/10.1186/s13073-016-0329-5
[6] G. Fazio, N. Turazzi, V. Cazzaniga, M. Kreuzaler, O. Maglia, C. Magnani, et al. tnfrsf13c (baffr) positive blasts persist after early treatment and at relapse in childhood b‐cell precursor acute lymphoblastic leukaemia, British Journal of Haematology, vol. 182, no. 3, p. 434-436, 2017. https://doi.org/10.1111/bjh.14794

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response.
Gene References into Functions
  1. the B-cell receptor BR3 modulates cellular branching via Rac1 during neuronal migration PMID:27436754
  2. Expression patterns of BAFF and its receptor BAFF-R differ according to lupus nephritis class. PMID:29087261
  3. up-regulated expression in intractable temporal lobe epilepsy PMID:28441631
  4. Inhibition of ADAM10 augments BAFF-dependent survival of primary human B cells, whereas inhibition of ADAM17 increases BAFFR expression levels. PMID:28249164
  5. Relationships between serum BAFF and BBR expression [(BAFFR, calcium signal modulating cyclophilic ligand interactor (TACI) and B cell maturation antigen (BCMA)] were determined on B cell subsets, defined using immunoglobulin (Ig)D/CD38. Twenty pre-RTX and 18 rheumatoid arthritis patients relapsing after B cell depletion were included. PMID:28800164
  6. Among the BAFF receptors in a cohort of rheumatoid arthritis (RA) patients, the AA have shown, by fluorescence activated cell sorter (FACS) analysis of median fluorescence intensity (MFI), that transmembrane activator and calcium-modulating cyclophilin ligand interactor (TACI) and B cell maturation antigen (BCMA) do not change PMID:28834574
  7. The expression levels of serum BAFF and the three receptors (TACI, BCMA and BAFF-R) in non-Hodgkin lymphoma patients were significantly higher than in healthy controls. PMID:28028945
  8. Variants in BAFF-R gene is associated with chronic lymphocytic leukemia. PMID:27468724
  9. BAFF-R, as the principal receptor of BAFF, not only decreased the apoptosis of B cells and CD8+ T cells by upregulating the expression of Bcl-2 and BclxL, but also promoted B-cell proliferation in immune thrombocytopenia. PMID:26749059
  10. genetic polymorphism contributes to the pathogenesis of primary antibody deficiency PMID:26613719
  11. BAFF and BAFF-R are expressed in the thyrocytes derived from patients with either autoimmune thyroid disorders or multinodular goiter, as well in the infiltrating immune cells of Graves' disease and Hashimoto's thyroiditis PMID:26214745
  12. There is an increased prevalence of the BAFF-R His159Tyr mutation in patients with Sjogren's syndrome (SS), particularly in those with SS complicated by MALT lymphoma whose disease onset occurred at a younger age. PMID:26097183
  13. Expression of mutant caspase-9 correlated with a downregulation of BAFFR (B-cell-activating factor belonging to the TNF family (BAFF) receptor) in B cells and ICOS (inducible T-cell costimulator) in T cells. PMID:25569260
  14. Variants of TNFRSF13C were associated with common variable immunodeficiency. PMID:26122175
  15. Negative expression of BAFF-R, but not of BAFF, could be an independent risk factor for progression-free survival and Overall survival in patients with diffuse large B-cell lymphoma treated with standard R-CHOP. PMID:26327569
  16. the common TLR4-D299G, TLR4-T399I and BAFFR-P21R polymorphisms provide the carriers with a protective advantage against ICU-acquired sepsis; this finding was more profound for medical patients compared to trauma or surgical ones PMID:25454804
  17. Data show significant differences in expression of tumour necrosis factor family (BAFF) receptors BAFF-R, BCMA and TACI in patients with and without anti-Jo-1 or anti-Ro52/anti-Ro60 autoantibodies. PMID:25301447
  18. In view of the restricted expression of the BAFF-R on normal cells and the multiple anti-pre-B ALL activities stimulated by this antibody, a further examination of its use for treatment of pre-B ALL is warranted. PMID:24825858
  19. Availability of BAFF determines BAFF-R and TACI expression on B cells in common variable immunodeficiency. PMID:24809296
  20. Our study demonstrates that BR3 is involved in the survival of cultured epithelial cells due to an autocrine effect of BAFF. PMID:24602383
  21. BAFF-R, but not BAFF, may have a role in progression-free survival and overall survival in follicular lymphoma PMID:23272079
  22. BLyS and its receptors are expressed by B lymphocytes in the peripheral blood and the bone marrow of patients with multiple myeloma. PMID:23276925
  23. P21R/H159Y TNFRSF13C compound heterozygous mutation and P21R heterozygous mutations were detected in Turkish patients with common variable immunodeficiency. PMID:22699762
  24. BAFF-R expression is tightly regulated during B-cell development in mouse and human and this exprssion is correlated with posirive selection. PMID:22028296
  25. It was also found that NF-kappaB was an important transcription factor involved in regulating BAFF-R expression through one NF-kappaB binding site in the BAFF-R promoter PMID:21607696
  26. Soluble BAFF levels inversely correlate with peripheral B cell numbers and the expression of BAFF receptors. PMID:22124120
  27. The activation profile of diffuse large B-cell lymphomas/posttransplantation lymphoproliferative disorders was not associated with BAFF/BAFF-R expression, whereas nuclear p52 activation might be linked to Epstein-Barr virus. PMID:21871426
  28. The human BAFF-R gene might be regulated via a transcriptional event through one putative NF-kappaB site on the BAFF-R gene promoter. PMID:21744373
  29. reduced expression via inhibition of the NF-KappaB pathway in B cells of rheumatoid arthritis patients PMID:21515993
  30. primary leukemia B-cell precursors aberrantly express receptors of the BAFF-system, BAFF-R, BCMA, and TACI PMID:21687682
  31. This is the first study, presenting together the TNFSF members APRIL, BAFF, TWEAK and their receptors in different areas of normal renal tissue and renal cell carcinoma. PMID:21483105
  32. BLyS and its receptors might have a potential role in the growth and survival of malignant plasma cells. PMID:19731825
  33. Results describe the mechanisms underlying aberrant BAFF-R expression in precursor B acute lymphoblastic leukemia (precursor B-ALL) and mature B chronic lymphocytic leukemia (CLL). PMID:21099364
  34. BAFF-R was rather specifically related to low growth activity of germinal center B-cell-like -type diffuse large B-cell lymphoma of nodal origin. PMID:21123970
  35. inverse correlation between BAFF and APRIL in Kawasaki disease is reversed by IVIG treatment PMID:20945608
  36. Elevated plasma BAFF and reduced BAFF receptor 3 (BR3) protein expression on peripheral B cells could act as biomarkers for active disease in systemic lupus erythematosus patients PMID:20974656
  37. a novel lymphoma-associated mutation in human BAFF-R that results in NF-kappaB activation and reveals TRAF6 as a necessary component of normal BAFF-R signaling. PMID:21041452
  38. Data from BAFF-R-expressing cells suggested potential regulatory sites in TNFRSF13C promoter region. PMID:20554963
  39. This report is the first showing universal expression of BAFF-R by pre-B ALL cells. PMID:20460528
  40. IFN-gamma and the NF-kappaB pathway could be involved in regulating the transcription and mRNA expression of BAFF-R gene. PMID:20230666
  41. the mechanism of transcriptional regulation of BAFF-R PMID:20025535
  42. BAFF-R is a receptor for the TNF family member ligand, BAFF [review] PMID:12456020
  43. BAFFR-mediated NF-kappa B activation and IL-10 production in B cells is downregulated by TNFR-associated factor-3. PMID:12471121
  44. crystal structure and interaction with BAFF protein PMID:12715002
  45. BAFF/BLyS receptor 3 comprises a minimal TNF receptor-like module that encodes a highly focused ligand-binding site. PMID:12755599
  46. Expression of BCMA, TACI, and BAFF-R by multiple myeloma cells support cell growth and survival. PMID:14512299
  47. This study reports the crystal structure of a 24-residue fragment of the cytoplasmic portion of BAFF-R bound in complex with TRAF3. PMID:15585864
  48. the PVPAT sequence of BAFFR not only functions as a key signaling motif of BAFFR but also determines its signaling specificity in the induction of the noncanonical NF-kappaB pathway PMID:15644327
  49. amino acid sequence of genomic DNA from blood of common variable immunodeficiency patients;mutations may result in humoral immunodeficiency PMID:16160919
  50. BAFF-R is expressed on most mature B cells and B-cell lymphoproliferative disorders. PMID:16226112

Show More

Hide All

Subcellular Location
Membrane; Single-pass type III membrane protein.
Tissue Specificity
Highly expressed in spleen and lymph node, and in resting B-cells. Detected at lower levels in activated B-cells, resting CD4+ T-cells, in thymus and peripheral blood leukocytes.
Database Links

HGNC: 17755

UNIGENE: Hs.344088

KEGG: hsa:115650

STRING: 9606.ENSP00000291232

OMIM: 606269

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products