Abbreviation
Recombinant Human RSPO1 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells is 1-10ng/ml.
Research Area
Developmental Biology
Alternative Names
CRISTIN3, FLJ40906, hRspo1, R spondin homolog, R spondin homolog (Xenopus laevis), R spondin1, R-spondin-1, Roof plate specific spondin, Roof plate-specific spondin-1, RP11-566C13.1, RSPO, Rspo1, RSPO1_HUMAN
Species
Homo sapiens (Human)
Expression Region
21-263aa
Target Protein Sequence
SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time maybe differs from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
R-spondin-1 is a critical potentiator of Wnt/β-catenin signaling, and this recombinant human RSPO1 demonstrates strong functional activity with an ED50 of 1–10 ng/ml in a TOPFlash reporter assay using HEK293T cells, confirming its capacity to robustly activate canonical Wnt pathway readouts. Covering the full-length mature protein (aa 21–263) with a C-terminal 6xHis tag, this construct is expressed in mammalian cells to preserve native glycosylation patterns essential for proper folding and receptor engagement with LGR4/5/6. This validated bioactivity supports use in intestinal and other adult stem cell organoid expansion, osteogenic differentiation studies, and receptor-ligand binding assays such as SPR or ELISA-based competition experiments. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based proliferation and survival assays as well as in vivo regenerative medicine models requiring stringent endotoxin control.