Abbreviation
Recombinant Human RSPO1 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤10 EU/mg by the LAL method
Activity
Measured by its ability to induce Topflash reporter activity in CHO cellsin the presence of 50ng/ml wnt3a. The expected ED50 is＜1.0 μg/ml.
Alternative Names
RSPO1; R-spondin1; RP11-566C13.1; CRISTIN3; FLJ40906; RSPO Rspo1; R-spondin; Rspondin; RP23-325M14.2; Roof plate-specific spondin-1
Species
Homo sapiens (Human)
Expression Region
21-263aa
Target Protein Sequence
SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
Tag free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
R-spondin-1 amplifies canonical Wnt signaling by engaging LGR4/5/6 receptors and neutralizing Wnt inhibitors, making it a critical regulator of stem cell self-renewal and tissue homeostasis. This recombinant protein, spanning the complete mature form (aa 21–263) and expressed in mammalian cells to preserve native glycosylation, demonstrates robust potentiation of Wnt3a-driven Topflash reporter activity in CHO cells with an ED50 below 1.0 μg/ml, confirming functional receptor engagement at physiologically relevant concentrations. The sub-micromolar potency supports its use in stem cell expansion protocols, intestinal organoid culture systems, and mechanistic studies of Wnt pathway modulation where precise dose-response relationships are essential. Endotoxin levels at or below 10 EU/mg and purity exceeding 95% align with standards expected in cell-based differentiation assays and receptor-ligand binding experiments, including surface plasmon resonance and competitive ELISA formats designed to map LGR interaction kinetics.
