Recombinant Human Peroxisomal biogenesis factor 19 (PEX19) (Active)

In Stock
Code: CSB-EP017802HU
Size:
20ug
20ug100ug1mg
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal GST-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human PEX19 protein (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 μg/ml can bind human PEX19, the EC50 of human PEX19 protein is 22.96-33.00 μg/ml.
Target Names
PEX19
Uniprot NO.
Research Area
Tags & Cell Markers
Alternative Names
33 kDa housekeeping protein; D1S2223E; HK33; Housekeeping gene 33kD; OK/SW-cl.22; PBD12A; Peroxin 19; Peroxin-19; Peroxisomal biogenesis factor 19; Peroxisomal farnesylated protein; PEX19; PEX19_HUMAN; PMP1; PMPI; PXF; PXMP1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-296aa
Target Protein Sequence
AAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
59.3kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 μg/ml can bind human PEX19, the EC50 of human PEX19 is 22.96-33.00 μg/ml.
Description

PEX19 serves as a critical cytosolic chaperone and import receptor for peroxisomal membrane proteins, making it indispensable for studying peroxisome biogenesis and associated disorders. This recombinant human PEX19 (aa 2–296, full-length mature protein) carries an N-terminal GST tag and demonstrates confirmed binding to immobilized ABCD1 in a functional ELISA, with an EC50 of 22.96–33.00 µg/ml — providing a reliable basis for protein–protein interaction studies, pull-down assays, and ELISA-based binding screens targeting the PEX19–cargo recognition pathway. Expressed in *E. coli*, the protein offers a cost-effective, non-glycosylated format that supports use in antibody development, assay standardization, and mechanistic studies of peroxisomal membrane protein trafficking. Purity exceeding 90% by SDS-PAGE meets the quality thresholds commonly required for quantitative binding assays and biochemical characterization, though researchers planning cell-based experiments should note that endotoxin levels have not been tested.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Necessary for early peroxisomal biogenesis. Acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Binds and stabilizes newly synthesized PMPs in the cytoplasm by interacting with their hydrophobic membrane-spanning domains, and targets them to the peroxisome membrane by binding to the integral membrane protein PEX3. Excludes CDKN2A from the nucleus and prevents its interaction with MDM2, which results in active degradation of TP53.
Gene References into Functions
  1. Thus, PEX19 and PEX3 peroxisome biogenesis factors provide an alternative posttranslational route for membrane insertion of the reticulon homology domain-containing proteins, implying that endoplasmic reticulum membrane shaping and peroxisome biogenesis may be coordinated. PMID:29396426
  2. The results demonstrate an allosteric mechanism for the modulation of PEX19 function by farnesylation. PMID:28281558
  3. that newly synthesized UBXD8 is post-translationally inserted into discrete ER subdomains by a mechanism requiring cytosolic PEX19 and membrane-integrated PEX3, proteins hitherto exclusively implicated in peroxisome biogenesis PMID:27295553
  4. suggest a novel regulatory mechanism for peroxisome biogenesis through the interaction between Pex19p and PLA/AT-3 PMID:26018079
  5. Thus within the cell, PEX3 is stabilized by PEX19 preventing PEX3 aggregation. PMID:25062251
  6. PEX19 formed a complex with the peroxisomal tail anchored protein PEX26 in the cytosol and translocated it directly to peroxisomes by a TRC40-independent class I pathway. PMID:23460677
  7. PEX3-PEX19 interaction is crucial for de novo formation of peroxisomes in peroxisome-deficient cells. PMID:22624858
  8. The Pex19p peptide contains a characteristic motif, consisting of the leucine triad (Leu18, Leu21, Leu22), and Phe29, which are critical for the Pex3p binding and peroxisome biogenesis. PMID:21102411
  9. The crystal structure of the cytosolic domain of PEX3 in complex with a PEX19-derived peptide. PEX3 adopts a novel fold that is best described as a large helical bundle. PMID:20554521
  10. data indicate a divided N-terminal and C-terminal structural arrangement in Pex19p, which is reminiscent of a similar division in the Pex5p receptor, to allow separation of cargo-targeting signal recognition and additional functions. PMID:20531392
  11. a considerable functional diversity of the proteins encoded by two PEX19 splice variants and thereby provide first experimental evidence for specific biological functions of the different predicted domains of the PEX19 protein. PMID:11883941
  12. PEX19 binds and stabilizes newly synthesized PMPs in the cytosol, binds to multiple PMP targeting signals (mPTSs), interacts with the hydrophobic domains of PMP targeting signals, and is essential for PMP targeting and import. PMID:14709540
  13. Interaction of PEX3 and PEX19 visualized by fluorescence resonance energy transfer (FRET). PMID:14713233
  14. Pex19p has a role in assembly of PTS-receptor docking complexes PMID:14715663
  15. Results suggest that PEX3 plays a selective, essential, and direct role in class I peroxisomal membrane protein import as a docking factor for PEX19. PMID:15007061
  16. human Pex19p domain architecture and activity PMID:15252024
  17. analysis of the PEX19-binding site of human adrenoleukodystrophy protein PMID:15781447
  18. Pex19p translocates the membrane peroxins from the cytosol to peroxisomes in an ATP- and Pex3p-dependent manner and then shuttles back to the cytosol PMID:16280322
  19. Pex19p binds to PMP70 co-translationally and keeps PMP70 in a proper conformation for the localization to peroxisome. PMID:16344115
  20. Nonfarnesylated and farnesylated human Pex19p display a similar affinity towards a select set of peroxisomal membrane proteins. PMID:16791427
  21. Data suggest that Pex19p probably functions as a chaperone for membrane proteins and transports them to peroxisomes by anchoring to Pex3p using residues 12-73 and 40-131. PMID:16895967
  22. either one or two tryptophan residues of Pex3p (Trp-104 and Trp-224) are directly involved in binding to Pex19p. PMID:18174172
  23. targeting of hFis1 to peroxisomes and mitochondria are independent events and support a direct, Pex19p-dependent targeting of peroxisomal tail-anchored proteins. PMID:18782765
  24. N-terminal domain of Pex14, Pex14(N), adopts a three-helical fold. Pex5 and Pex19 ligand helices bind competitively to the same surface in Pex14(N) albeit with opposite directionality. PMID:19197237
  25. ALDRP interacts with PEX19 splice variants PEX19-delta-E2 and PEX19-delta-E8. PMID:11883941
  26. LDRP (ABCD2) interacts with both farnesylated wild-type and farnesylation-deficient mutant PEX19. This interaction is mediated by amino acids 1-218 of ALDRP. PMID:10777694
  27. MP70 (ABCD3) interacts with both farnesylated wild-type and farnesylation-deficient mutant PEX19. PMID:10777694
  28. MP70 interacts with PEX19 splice variants PEX19-delta-E2 and PEX19p-delta-E8. PMID:11883941

Show More

Hide All

Subcellular Location
Cytoplasm. Peroxisome membrane; Lipid-anchor; Cytoplasmic side.
Protein Families
Peroxin-19 family
Tissue Specificity
Ubiquitously expressed. Isoform 1 is strongly predominant in all tissues except in utero where isoform 2 is the main form.
Database Links

HGNC: 9713

UNIGENE: Hs.517232

KEGG: hsa:5824

STRING: 9606.ENSP00000357051

OMIM: 600279

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products