Abbreviation
Recombinant Human LIF protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤10 EU/mg by the LAL method
Activity
Measured in the M1 cell differentiation assay. The ED50 is ≤0.2ng/ml.
Alternative Names
Leukemia Inhibitory Factor; LIF; Differentiation-Stimulating Factor; D Factor; Melanoma-Derived LPL Inhibitor; MLPLI; Emfilermin; LIF; HILDA
Species
Homo sapiens (Human)
Expression Region
23-202aa
Target Protein Sequence
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
Tag free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
Leukemia inhibitory factor governs pluripotency maintenance in embryonic stem cells and drives differentiation in hematopoietic lineages, making precise control of its signaling essential in both stem cell biology and immunology experiments. This tag-free preparation, spanning the full mature sequence (aa 23–202), demonstrates potent bioactivity with an ED50 ≤0.2 ng/ml in the M1 myeloid leukemia cell differentiation assay, providing a quantitative benchmark for dose-response studies in cell fate decisions and JAK/STAT pathway activation experiments. The endotoxin specification of ≤10 EU/mg aligns with standards expected in primary immune cell cultures and hematopoietic differentiation protocols, where LPS contamination would confound cytokine-specific responses. Purity exceeding 95% by SDS-PAGE, combined with the validated differentiation activity, supports use in functional assays examining lineage commitment, in antibody development workflows requiring a native immunogen, and as a reference standard in LIF detection platforms.
