Recombinant Human IGF-like family receptor 1 (IGFLR1), partial (Active)

CSB-MP862025HU
Size:
20ug
20ug100ug1mg
US$138
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/mL can bind Human IGFL1 (CSB-MP764932HU), the EC50 is 32.33-47.52 ng/mL.
Target Names
IGFLR1
Uniprot NO.
Alternative Names
(Transmembrane protein 149)(U2 small nuclear RNA auxiliary factor 1-like 4)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
23-163aa
Target Protein Sequence
SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP
Mol. Weight
17.4 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/ml can bind Human IGFL1 (CSB-MP764932HU), the EC50 is 32.33-47.52 ng/mL.
Description

This Human IGFLR1 (TMEM149, U2AF1L4) recombinant protein was produced in Mammalian cell, where the gene sequence encoding Human IGFLR1 (23-163aa) was expressed with the C-terminal 6xHis tag. The purity of this IGFLR1 protein was greater than 95% by SDS-PAGE. The activity was measured by its binding ability in a functional ELISA.

IGFLR1 may also be involved in the immune system as a member of the TNF receptor family. Studies have found that in colorectal cancer, IGFLR1 is highly expressed on the surface of CD8+ T cells and has the function of depleting T cells. Inhibiting the expression of IGFLR1 may slow the progression of colorectal cancer tumors. In colorectal cancer patients, CXCL13+TH1-like cells may affect the therapeutic effect of immune checkpoint inhibitors. IGFLR1 is a type of receptor protein that is highly expressed on CXCL13+TH1-like cells. In vitro experiments in vivo demonstrated that IGFLR1, as a co-stimulatory factor, may become a potential drug therapy target.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
Gene References into Functions
  1. Murine insulin growth factor-like (IGFL) and human IGFL1 proteins are induced in inflammatory skin conditions and bind to a novel tumor necrosis factor receptor family member, IGFLR1. PMID:21454693

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Database Links

HGNC: 23620

UNIGENE: Hs.352548

KEGG: hsa:79713

STRING: 9606.ENSP00000246532

OMIM: 614143

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products