Recombinant Human IGF-like family receptor 1 (IGFLR1), partial (Active)

CSB-MP862025HUd9
Size:
20ug
20ug100ug1mg
US$138
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal hFc1-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.
Promotion

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/mL can bind Human IGFL1 (CSB-MP764932HUh8), the EC50 is 4.640-5.722 ng/mL.
Target Names
IGFLR1
Uniprot NO.
Alternative Names
(Transmembrane protein 149)(U2 small nuclear RNA auxiliary factor 1-like 4)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
23-163aa
Target Protein Sequence
SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP
Mol. Weight
44.1 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/ml can bind Human IGFL1 (CSB-MP764932HUh8), the EC50 is 4.640-5.722 ng/mL.
Description

The recombinant human IGFLR1 protein production follows a workflow of gene cloning, plasmid construction, protein expression, purification, and analysis. It is expressed in mammalian cells. Its expression region corresponds to the 23-163aa of the human IGFLR1. It is fused with a hFc-tag at the C-terminus. The resulting recombinant IGFLR1 protein is purified using affinity chromatography. SDS-PAGE analysis confirms the IGFLR1 protein purity exceeds 95%, and the LAL method detects its endotoxin levels of <1.0 EU/μg. Functional ELISA shows its specific binding with the human IGFL1 (CSB-MP764932HUh8), with an EC50 of 4.640-5.722 ng/mL.

IGFLR1 is a transmembrane protein primarily expressed on T cells [1]. It bears structural similarities to the TNFR family members, and human and mouse IGFLR1 share 61% amino acid sequence identity [1].

IGFLR1 is most abundantly expressed on T cells in mice, and in both human and mouse skin models, its expression is induced under inflammatory conditions, suggesting it may act as a regulatory element in T cell response in the skin [2]. Several studies have found that IGFLR1 is associated with immune regulation and infiltration in various cancers, including clear cell renal cell carcinoma, colorectal cancer, and non-small cell lung cancer [3][4][5][6]. IGFLR1 expression is elevated on the surface of CD8+ T cells in colorectal cancer, where it may contribute to T cell exhaustion [3]. Additionally, a specific cluster of TH1-like T cells co-expressing CXCL13 and BHLHE40 and exhibiting high levels of IGFLR1 was linked to microsatellite-instable colorectal tumors [4][5][6].

References:
[1] Y. Cao, G. Arora, A. Gupta, C. Booth, K. Murfin, J. Černý, et al. An ixodes scapularis protein disulfide isomerase contributes to borrelia burgdorferi colonization of the vector, Infection and Immunity, vol. 88, no. 12, 2020. https://doi.org/10.1128/iai.00426-20
[2] R. Ehmann, K. Brandes, M. Antwerpen, M. Walter, K. Schlippenbach, E. Stegmaier, et al. Molecular and genomic characterization of a novel equine molluscum contagiosum-like virus, Journal of General Virology, vol. 102, no. 3, 2021. https://doi.org/10.1099/jgv.0.001357
[3] W. Song, Y. Shao, X. He, P. Gong, Y. Yang, S. Huang, et al. Igflr1 as a novel prognostic biomarker in clear cell renal cell cancer correlating with immune infiltrates, Frontiers in Molecular Biosciences, vol. 7, 2020. https://doi.org/10.3389/fmolb.2020.565173
[4] N. Wang, R. Wang, X. Li, Z. Song, L. Xia, J. Wang, et al. Tumor microenvironment profiles reveal distinct therapy-oriented proteogenomic characteristics in colorectal cancer, Frontiers in Bioengineering and Biotechnology, vol. 9, 2021. https://doi.org/10.3389/fbioe.2021.757378
[5] L. Zhang and Z. Zhang. Recharacterizing tumor-infiltrating lymphocytes by single-cell rna sequencing, Cancer Immunology Research, vol. 7, no. 7, p. 1040-1046, 2019. https://doi.org/10.1158/2326-6066.cir-18-0658
[6] Y. Li, J. Jin, & F. Bai. Cancer biology deciphered by single-cell transcriptomic sequencing, Protein & Cell, vol. 13, no. 3, p. 167-179, 2021. https://doi.org/10.1007/s13238-021-00868-1

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
Gene References into Functions
  1. Murine insulin growth factor-like (IGFL) and human IGFL1 proteins are induced in inflammatory skin conditions and bind to a novel tumor necrosis factor receptor family member, IGFLR1. PMID:21454693

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Database Links

HGNC: 23620

UNIGENE: Hs.352548

KEGG: hsa:79713

STRING: 9606.ENSP00000246532

OMIM: 614143

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products