Recombinant Human Galectin-8 (LGALS8) (Active)

CSB-EP012894HU
Size:
20ug
20ug100ug1mg
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal GST-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized SLC31A1 at 5 μg/ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 μg/ml.
Target Names
LGALS8
Uniprot NO.
Research Area
Cancer
Alternative Names
Gal 8; Gal-8; Gal8; Galectin 8; Galectin-8; galectin-8g; Lectin galactoside binding soluble 8; LEG8_HUMAN; LGAL S8 ; Lgals8; PCTA 1; PCTA-1; PCTA1; Po66 carbohydrate binding protein; Po66 carbohydrate-binding protein; Po66 CBP ; Po66-CBP; Prostate carcinoma tumor antigen 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-317aa
Target Protein Sequence
MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Mol. Weight
62.8kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized SLC31A1 at 5 μg/ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 μg/ml.
Description

Recombinant Human Galectin-8 (LGALS8) is a full-length protein expressed in E. coli with an N-terminal GST tag. The protein achieves a purity level above 90% as assessed by SDS-PAGE, which appears to provide reliable quality for research applications. Its biological activity has been confirmed through binding capacity in a functional ELISA, where it binds to immobilized SLC31A1 with an EC50 range of 373.90-524.30 μg/ml. This suggests consistent performance in experimental settings.

Galectin-8 belongs to the galectin family, known for binding beta-galactoside sugars. It likely plays important roles in various biological processes, including cell adhesion, migration, and immune response modulation. Galectin-8 appears to be involved in intracellular signaling pathways. Numerous studies have focused on this protein due to its significance in cellular interactions and potential implications in various physiological and pathological processes.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies with SLC31A1

This recombinant LGALS8 is confirmed to bind SLC31A1 but with very low affinity (EC₅₀ 373.90-524.30 μg/ml), which may not reflect physiological binding kinetics. The high EC₅₀ suggests potential issues with protein folding, activity, or steric hindrance from the N-terminal GST tag. Researchers should validate binding parameters with tag-free LGALS8 or mammalian-expressed protein to ensure biological relevance. The GST tag may facilitate immobilization but could distort interaction studies.

2. GST Pull-Down Assays for Binding Partner Identification

The GST tag enables pull-down assays, but the very high EC₅₀ indicates poor binding functionality, which may lead to false negatives or weak interactions. While the full-length sequence (1-317aa) contains all domains, the E. coli expression lacks glycosylation, and the GST tag may cause non-specific binding. Identified interactors should be validated with native LGALS8 from mammalian cells to confirm physiological relevance.

3. Antibody Development and Validation

This full-length LGALS8 serves as an antigen for antibody development, but the GST tag may induce tag-specific antibodies, reducing antibodies against LGALS8-specific epitopes. The E. coli expression produces a non-glycosylated protein, which may not mimic native glycosylated LGALS8. Antibodies should be validated against mammalian-derived LGALS8 to ensure recognition of physiological forms.

4. Functional ELISA Development and Optimization

The protein can be used for ELISA development, but the very high EC₅₀ (μg/ml range) indicates low sensitivity, making assays impractical for most applications. The GST tag may affect antigen presentation. Researchers should optimize assays with lower EC₅₀ standards or consider tag-free LGALS8 for better performance. The wide EC₅₀ range (373.90-524.30 μg/ml) suggests variability that may affect reproducibility.

5. Biochemical Characterization and Structure-Function Studies

The protein is suitable for basic biochemical studies, but the GST tag may alter protein stability and structure, complicating interpretation. Techniques like circular dichroism may be affected by the tag's presence. The high EC₅₀ suggests possible misfolding or inactivity, so structural conclusions should be validated with tag-free, active LGALS8. E. coli expression lacks glycosylation, which is important for galectin function.

Final Recommendation & Action Plan

This recombinant human LGALS8 with an N-terminal GST tag has confirmed but very weak binding activity (EC₅₀ ~400-500 μg/ml), indicating potential issues with folding or tag interference. It can be used for preliminary studies but requires rigorous validation. For interaction studies, prioritize tag removal or use mammalian-expressed LGALS8 for physiological relevance. For pull-down assays, the GST tag is useful, but include stringent controls (e.g., GST-alone) and validate hits with native protein. For antibody development, this protein can immunize animals but screen clones against glycosylated LGALS8 to avoid tag-specific or non-physiological antibodies. Avoid functional assays requiring high sensitivity due to the low affinity; instead, use it for qualitative binding checks. For biochemical studies, the tag may need cleavage for accurate structural insights. Always confirm key findings with properly modified, full-length LGALS8 expressed in mammalian systems to account for glycosylation and folding. The purity (>90%) is acceptable but may require further purification for sensitive applications. Given the high EC₅₀, this protein is best suited for applications where activity is not critical, such as initial antibody generation or training assays, but not for detailed kinetic or functional studies without further optimization.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Beta-galactoside-binding lectin that acts as a sensor of membrane damage caused by infection and restricts the proliferation of infecting pathogens by targeting them for autophagy. Detects membrane rupture by binding beta-galactoside ligands located on the lumenal side of the endosome membrane; these ligands becoming exposed to the cytoplasm following rupture. Restricts infection by initiating autophagy via interaction with CALCOCO2/NDP52. Required to restrict infection of bacterial invasion such as S.typhimurium. Also required to restrict infection of Picornaviridae viruses. Has a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans.
Gene References into Functions
  1. analysis of crystallographic structures of the galectin-8 N-terminal domain (galectin-8N) in complex with LNT and LNnT PMID:28000747
  2. Gal-8 served as a new positive prognostic factor for the OS and DFS of ovarian cancer patients. PMID:29361803
  3. the natural and conserved expression of Gal-8 in tumour cells is responsible for the metastatic evolution of prostate cancer. PMID:28591719
  4. Both Gal-8 isoforms led to enhanced adhesion of myeloma cells to vascular endothelium under dynamic shear stress conditions, Gal-8L (by more than 40-fold) even stronger than Gal-8S. PMID:27287437
  5. Our data indicate that Gal-8 interacts with ALCAM at the surface of breast cancer cells through glycosylation-dependent mechanisms. A novel heterophilic interaction between ALCAM and Gal-8 is demonstrated here, suggesting its physiologic relevance in the biology of breast cancer cells PMID:27130882
  6. we detected Gal-8 in human cerebrospinal fluid, suggesting a role in the CNS immune-surveillance circuit. In addition, we show that MS patients generate function-blocking anti-Gal-8 antibodies with pathogenic potential. Furthermore, circulating anti-Gal-8 antibodies associate with relapsing-remitting MS, and not with progressive MS phenotypes, predicting clinical disability at diagnosis within the first year of follow-up PMID:28650992
  7. Data suggest that galectin-8 is a potential independent favorable prognostic biomarker for survival and recurrence of patients with gastric cancer after surgery. PMID:27444274
  8. this study uncovers a unique molecular mechanism of lymphangiogenesis in which galectin-8-dependent crosstalk among VEGF-C, podoplanin and integrin pathways plays a key role. PMID:27066737
  9. Platelet-derived factor V/Va is generated following endocytosis of the plasma-derived molecule by the platelet precursor cells, megakaryocytes, via a two receptor system consisting of LRP-1 and an unidentified specific "binding site". PMID:25800007
  10. Gal-8 expression is a potential independent unfavorable prognostic indicator for postoperative recurrence of patients with localized pT1 clear cell renal cell carcinoma PMID:25499921
  11. The fundamental roles of galectin-8 in human anaplastic large cell lymphoma PMID:25573487
  12. The implications of gal-8 in tumor angiogenesis remain to be further explored, but it is exciting to speculate that modulating gal-8-glycan interactions could be used to block lymphatic-vascular connections vital for metastasis PMID:24939370
  13. We integrate here the available information on Gal-8 expression in different tumor types and attempt to elucidate associations of its expression and localization with tumor progression[review] PMID:24696431
  14. these results not only confirm the pro-inflammatory role we have already proposed for Gal-8 in other cellular systems but also suggest that this lectin is orchestrating the interaction between leukocytes, platelets and endothelial cells PMID:24957054
  15. Focusing on the F19Y change in galectin-8, we study of consequences of a single-site substitution in the carbohydrate recognition domain of this family of cellular effectors. PMID:24418318
  16. analysis of how human Galectin-8C domain interacts with its glycan ligands PMID:23555773
  17. Data indicate that the binding site in galectin-8 is essential for the recruitment of the autophagy receptor NDP52 to cytosol-exposed Salmonella Typhimurium. PMID:23386746
  18. Association of galectin-8 (F19Y) occurrence with autoimmune diseases in a Caucasian population. PMID:22683700
  19. Galectin-8 promotes cytoskeletal rearrangement in trabecular meshwork cells through activation of Rho signaling. PMID:22973445
  20. Results indicate a difference in specificity between N-terminal and C-terminal carbohydrate recognition domains (N-CRD and C-CRD) of galectin-8. PMID:22913484
  21. This is the first study that relates a galectin, an endogenous lectin family, to IgA nephritis and thus should stimulate new avenues of research into the pathophysiology of the disease. PMID:22173878
  22. a novel role for the tandem repeat Gal8 in promoting FV endocytosis. PMID:22267735
  23. results illustrate how cells deploy the danger receptor galectin 8 to combat infection by monitoring endosomal and lysosomal integrity on the basis of the specific lack of complex carbohydrates in the cytosol PMID:22246324
  24. Gal-8 was expressed by villous and extravillous cytotrophoblast. PMID:21862124
  25. galectin-8 loss might be an early step in the development of malignant lesions of the bladder and is a significant independent predictor of recurrence PMID:21757871
  26. Galectin-8-N-domain recognition mechanism for sialylated and sulfated glycans. PMID:21288902
  27. Studies indicated that Gal-8 was expressed both in the cytoplasm and nucleus in ECs of normal and tumor vessels. PMID:20876211
  28. Platelets not only contain Gal-8, but also expose Gal-8 after thrombin activation. Findings reveal Gal-8 isoforms as a potent platelet activator; immobilized Gal-8 promotes platelet adhesion/spreading. PMID:20858220
  29. Galectin-8 up-regulation is associated with hypopharyngeal and laryngeal tumor progression. PMID:20044599
  30. The binding ability of galectin-8 to membrane-associated GM3 was confirmed using CHO cells, which predominantly express GM3 PMID:12851289
  31. Human galectin-8 induced firm and reversible adhesion of peripheral blood neutrophils but not eosinophils to a plastic surface in a lactose-sensitive manner; galectin-8 is a novel factor that modulates the neutrophil function. PMID:12881409
  32. REVIEW: isoforms and role in neoplastic transformation/cancer PMID:14758080
  33. galectin-8 is a modulator of cellular growth through up-regulation of p21 PMID:15753078
  34. Gal-8 constitutes a novel extracellular stimulus for T cells, able to bind specific beta1 integrins and to trigger signaling pathways conducive to cell spreading. PMID:16368432
  35. The affinity of Gal-8 and its carbohydrate recognition domains for ligands in solution and at the cell surface is explored. PMID:17339281
  36. galectin-8 sorting is based on carbohydrate fine specificity PMID:17580315
  37. The function of galectin-8 in Jurkat T-cells, is analysed. PMID:18024965
  38. allows Gal-8 to signal phosphatidylserine exposure in leukocytes entirely through C-terminal domain recognition of polyLacNAc glycans PMID:18456665
  39. Gal8 modulates trabecular meshwork cell adhesion and spreading, at least in part, by interacting with alpha2-3-sialylated glycans on beta(1) integrins. PMID:18849583
  40. Galectin-8 was expressed in the majority of papillary carcinomas. Positive but weaker staining was found in some of follicular thyroid carcinomas and adenomas. Galectin-8 found in hyperplastic areas adjacent to tumor was weakly positive in 9 of 31 cases. PMID:19009371
  41. These data suggest a role for galectin-8 and podoplanin in supporting the connection of the lymphatic endothelium to the surrounding extracellular matrix, most likely in cooperation with other glycoproteins on the surface of lymphatic endothelial cells. PMID:19268462
  42. The glycan-binding proteins of the galectin family can modulate the immune system. Anti-galectin autoantibodies thus could have functional and/or pathogenic implications in inflammatory processes and autoimmunity. PMID:19395456
  43. crystal of a protease-resistant mutant form of human galectin-8 was obtained using the hanging-drop method and was found to belong to the tetragonal space group P4(3)2(1)2 PMID:19407390

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle. Cytoplasm, cytosol.
Tissue Specificity
Ubiquitous. Selective expression by prostate carcinomas versus normal prostate and benign prostatic hypertrophy.
Database Links

HGNC: 6569

UNIGENE: Hs.4082

KEGG: hsa:3964

OMIM: 606099

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products