Abbreviation
Recombinant Human LGALS8 protein (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized SLC31A1 at 5 μg/ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 μg/ml.
Alternative Names
Gal 8; Gal-8; Gal8; Galectin 8; Galectin-8; galectin-8g; Lectin galactoside binding soluble 8; LEG8_HUMAN; LGAL S8 ; Lgals8; PCTA 1; PCTA-1; PCTA1; Po66 carbohydrate binding protein; Po66 carbohydrate-binding protein; Po66 CBP ; Po66-CBP; Prostate carcinoma tumor antigen 1
Species
Homo sapiens (Human)
Expression Region
1-317aa
Target Protein Sequence
MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized SLC31A1 at 5 μg/ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 μg/ml.
Description
Galectin-8 plays a multifaceted role in tumor progression by modulating cell adhesion, apoptosis, and immune evasion, making it a valuable target in cancer biology research. This recombinant human LGALS8 (full-length, aa 1–317) carries an N-terminal GST tag and has been functionally validated by ELISA, demonstrating specific binding to immobilized SLC31A1 with an EC50 of 373.90–524.30 μg/ml — evidence that supports use in protein–protein interaction studies, ligand-binding assays, and as a positive control in galectin-focused screening panels. Produced in *E. coli*, the protein provides a non-glycosylated format that isolates lectin-intrinsic binding activity from mammalian glycosylation artifacts, which is particularly informative when dissecting carbohydrate-independent interactions. Purity exceeding 90% by SDS-PAGE satisfies the quality thresholds commonly required for functional ELISAs and in vitro binding characterization, though researchers planning cell-based assays should note that endotoxin levels have not been tested and may require additional assessment.
