Home
Product
Protein
Active Protein
Other
Recombinant Human Folate receptor alpha(FOLR1),partial (Active)

Recombinant Human Folate receptor alpha(FOLR1),partial (Active)

In Stock

Code: CSB-MP008784HU1

Rate （N/A）
Review （0）

Size:

20ug100ug1mg

US$144

Quantity:

Express system: Mammalian cell

Species: Homo sapiens (Human)

Tag Info: C-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Human FOLR1 protein, partial (Active)

Purity

Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized human FOLR1 at 2 μg/mL can bind Anti-FOLR1 recombinant antibody(CSB-RA008784MA1HU). The EC50 is 6.893-7.883 ng/mL.

Target Names

FOLR1

Uniprot NO.

P15328

Alternative Names

FOLR

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

25-233aa

Target Protein Sequence

RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

25.9 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Storage

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Lead Time

3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Shelf Life

The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Activity
Measured by its binding ability in a functional ELISA. Immobilized human FOLR1 at 2 μg/ml can bind Anti-FOLR1 recombinant antibody(CSB-RA008784MA1HU). The EC₅₀ is 6.893-7.883 ng/mL.
The purity of FOLR1 was greater than 95% as determined by SEC-HPLC

Description

Folate receptor alpha mediates cellular uptake of folate and folate-conjugated therapeutics, making it a validated target in oncology and antibody-drug conjugate development. This mammalian-expressed construct spanning residues 25–233 captures the extracellular ligand-binding domain with native glycosylation patterns that preserve conformational epitopes critical for therapeutic antibody screening and epitope mapping studies. Functional ELISA validation demonstrates specific antibody binding with an EC50 of 6.893–7.883 ng/mL, confirming that the protein retains native structure suitable for competitive inhibition assays, blocking antibody screening, and affinity characterization by surface plasmon resonance or biolayer interferometry. The combination of >95% purity and <1.0 EU/μg endotoxin meets the quality thresholds commonly required for ligand-binding assays, small-molecule inhibitor screening, and use as a positive control in receptor-ligand interaction studies targeting folate pathway biology.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. Required for normal embryonic development and normal cell proliferation.

Gene References into Functions

This study demonstrated a new approach using a combination of EpCAM and FRalpha as CTC-capture targets to increase the sensitivity of CTC detection in NSCLC efficiently, specifically, and quickly. PMID:29352248
Several experimental studies in mice and human epidemiological and genetics studies have suggested that FOLR1 abnormalities are involved in a portion of human neural tube defects (NTD), although the solo defect of FOLR1 did not cause NTD. (Review) PMID:28244241
that FOLR1 is highly expressed in ovarian cancer but is reduced following multidrug resistance. FOLR1 may be a useful biomarker for ovarian cancer, and it may be useful as a therapeutic application to improve sensitivity to cisplatin treatment PMID:29433550
mTORC1 or mTORC2 silencing markedly decreases the plasma membrane expression of FR-alpha and RFC transporter isoforms without affecting global protein expression PMID:27562465
High Folate Receptor Alpha Expression Is Associated With Increased Risk of Recurrence in Triple-negative Breast Cancer. PMID:28410844
The expression of folate receptor 1 (FOLR1) was significantly higher and occurred with higher frequency in metastatic lymph node samples from patients with advanced lung cancer. PMID:29110850
We identified eight novel variants in SLC19A1 and twelve novel variants in FOLR1, FOLR2, and FOLR3. Pathogenic variants include c.1265delG in SLC19A1 resulting in an early stop codon, four large insertion deletion variants in FOLR3, and a stop_gain variant in FOLR3 PMID:28948692
In this study, folate receptor alpha (FRa)-targeted nano-liposomes (FLP) were designed to enhance the anti-tumor effect by targeting delivery of exogenous PEDF gene to cervical cancer cells..These results clearly showed that FLP were desired carriers for PEDF gene and FLP/PEDF might represent a potential novel strategy for gene therapy of cervical cancer. PMID:27576898
Data show that higher folate receptor alpha (FRalpha) expression is predictive of a favorable prognosis in pancreatic ductal adenocarcinoma (PDAC) and FRalpha may represent a promising target for treatments. PMID:28430580
our results demonstrate the substantial therapeutic potential of novel 6-substituted pyrrolo[2,3-d]pyrimidine antifolates with dual targeting of PCFT and FRalpha toward Epithelial ovarian cancer that express a range of FRalpha, along with PCFT, as well as cisplatin resistance PMID:28138029
Low expression level of FOLR1 is associated with neuroendocrine lung tumors. PMID:27064343
FolR1 is a predictive candidate and a therapeutic target for medulloblastoma. PMID:28416738
Folr1 is a favorable target for fluorescence-guided surgery as tumor specific agent EC17 produced a clear fluorescent signal in ovarian and breast cancer tissue. PMID:27014973
The Folate receptor alpha is associated with the progression of cervical cancer and regulates cervical cancer cells growth through phosphorylating ERK1/2, c-Fos, and c-Jun, which are key factors of the ERK signaling pathway. PMID:28782518
Folate receptor alpha protein was expressed in the majority of lung adenocarcinomas and a minority of lung squamous cell carcinomas. Folate receptor alpha protein expression correlated with histologic grade for lung adenocarcinomas, and the greatest difference was observed between grade 1 and grade 3. PMID:26599808
The present study shows the efficacy of silencing HuR in lung cancer cells using folate-conjugated nanoparticle system that is directed towards folate receptor-alpha overexpressing cancer cells. PMID:27328938
This new protocol opens an effective way through synthesis and design of novel fluorescent nano-conjugates for FR expression investigation in tumor cells via targeted imaging, showing great potential in drug delivery mechanism study and cancer therapy PMID:26606305
Suppression of FOLR1 by RNA interference altered gene expression profile of taxol-resistant nasopharyngeal carcinoma cells. Apoptosis-related genes, gene alterations in viral carcinogenesis/MAPK pathways may be important for taxol resistance reversal. PMID:26617855
we confirmed the similarities between epithelial ovarian cancer and fallopian tube, normal and adenocarcinoma using FOLR1, FOLR2, CD68 and CD11b markers PMID:25971554
Suggest RNA CAR T cell therapy for the treatment of common epithelial cancers expressing folate receptor-alpha. PMID:26359629
Folate receptor expression on murine and human adipose tissue macrophages PMID:26149693
Findings suggest the clinical development of IMGN853 as a novel targeted therapy for patients with folate receptor alpha (FRalpha)-expressing tumors. PMID:25904506
Suggest that FRalpha overexpression may play a role in the endometrioid endometrium carcinoma carcinogenesis and carcinoma progression from endometrial hyperplasia. PMID:26191275
triple negative/basal tumors were significantly associated with increased expression of FOLR1 mRNA, compared to ER+ and HER2+ tumors. PMID:25816016
Molecular dynamic simulation of the binding process of folic acid to folate receptor alpha PMID:25323390
Studies indicate folate receptor (FR) as a prognostic biomarker for ovarian cancer. PMID:25564455
The overexpression of folate receptor alpha mRNA was associated with growth of pituitary adenomas. PMID:26014017
this is the first study to simultaneously evaluate both DNA methylation and protein expression of all three folate transporter genes, FOLR1, PCFT, and RFC1, in colorectal cancer. PMID:25697897
FRalpha down-regulation might be capable of suppressing cervical cancer cell proliferation and promoting apoptosis. PMID:25081683
Survival times are improved in non-small-cell lung cancer patients whose tumors show strong membranous folate receptor alpha expression. PMID:24993594
the conditions associated with circulating FOLR1 protein in healthy individuals PMID:24810481
We concluded that quantitation of CTCs through FRalpha ligand-PCR could be a promising method for noninvasive diagnosis of bladder TCC. PMID:24771263
74% of ER/PR-negative and 80% of triple-negative breast cancers expressed folate receptor alpha (FRA). The expression of FRA was significantly associated with a worse disease-free survival. PMID:24028341
Expression of FOLR1 is higher in pituitary adenomas of patients who are older than 50 years. PMID:23023342
FOLR1 was significantly elevated in the serum of ovarian cancer patients compared to serum of both healthy controls and patients with benign gynecological conditions. PMID:23528302
The FRalpha gene was expressed in all parathyroid cells analyzed, and the FRbeta gene was expressed by most. PMID:24206618
crystal structure of human FRalpha in complex with folic acid at 2.8 A resolution PMID:23851396
The data presented further support the hypothesis that folate receptor-alpha expression in gynecologic tumors is due to the cell of origin normally expressing this receptor PMID:23518909
EpCAM, FR-alpha, and VEGF-A are the most promising molecules for use in targeted intraoperative fluorescence imaging of endometriotic lesions owing to their favorable expression patterns and biomarker characteristics PMID:23332132
Studies indicate that folate receptor alpha (FOLR1), a folate transporter, is an attractive target for cancer therapy due to its high affinity for folate, restricted range of expression in normal tissue and differential over-expression in malignant tissue. PMID:23357463
Overexpression of folate receptor alpha was associated with ovarian tumor progression. PMID:23144806
The folate receptor alpha translocates to the nucleus, where it binds to cis-regulatory elements at promoter regions of Fgfr4 and Hes1, and regulates their expression. PMID:23243496
a large percentage of lung cancers, including squamous cell carcinomas in addition to adenocarcinomas, strongly express folate receptor alpha PMID:22984810
PCR analysis had confirmed the existence of FR-alpha, SMVT, and B ((0, +)) in Y-79 and ARPE-19 cells. PMID:22304562
High folate receptor alpha is associated with adenocarcinoma in non-small-cell lung carcinoma and and EGFR [corrected] mutation. PMID:22729036
alpha-FR can be a potential biomarker for the prediction of chemotherapeutic responses and clinical prognosis. PMID:22265591
studies suggest that different clinical severities do not necessarily correlate with residual function of folate receptor alpha mutants. PMID:22586289
FR-alpha was expressed in the majority of serous ovarian tumors, although >50% of cases showed only weak expression. PMID:21647742
FRalpha may play an important role in the development and progression of NFAs. PMID:22089756
An ancient double-mutated haplotype 1816delC-1841A in the FOLR1 gene, is demonstrated. PMID:21938430

Hide All

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor. Secreted. Cytoplasmic vesicle. Cytoplasmic vesicle, clathrin-coated vesicle. Endosome. Apical cell membrane. Note=Endocytosed into cytoplasmic vesicles and then recycled to the cell membrane.

Protein Families

Folate receptor family

Tissue Specificity

Primarily expressed in tissues of epithelial origin. Expression is increased in malignant tissues. Expressed in kidney, lung and cerebellum. Detected in placenta and thymus epithelium.

Database Links

HGNC: 3791

UNIGENE: Hs.73769

KEGG: hsa:2348

STRING: 9606.ENSP00000308137

OMIM: 136430

Promotions