Abbreviation
Recombinant Human FGF-9 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤10 EU/mg by the LAL method
Activity
Measured in a cell proliferation assay using NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 1-3 ng/mL.
Alternative Names
Fibroblast Growth Factor 9; FGF-9; Glia-Activating Factor; GAF; Heparin-Binding Growth Factor 9; HBGF-9; FGF9
Species
Homo sapiens (Human)
Expression Region
3-208aa
Target Protein Sequence
PLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
Tag free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
FGF9 plays a critical role in glial cell activation, limb development, and lung morphogenesis, making it a key target for studies of tissue repair and organogenesis. This mammalian-expressed protein spanning residues 3–208 demonstrates robust mitogenic activity in NIH3T3 fibroblast proliferation assays, with an ED50 of 1–3 ng/mL, providing a quantitative benchmark for dose-response experiments in cell survival and expansion protocols. The low ED50 supports its use in stem cell differentiation models—particularly osteogenic and neuronal lineages—as well as in receptor-ligand binding assays such as ELISA and surface plasmon resonance, where native-like folding is essential for accurate affinity measurements. Purity exceeding 95% by SDS-PAGE and endotoxin levels ≤10 EU/mg align with standards expected in angiogenesis models, wound healing assays, and antibody characterization workflows where low contaminant interference is critical.