Abbreviation
Recombinant Human FGF9 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 1-5 ng/ml.
Research Area
Signal Transduction
Alternative Names
FGF 9; FGF-9; FGF9; FGF9_HUMAN; Fibroblast growth factor 9; GAF (Glia-activafibroblast growth factor 9 (glia-activating factor); GAF; Glia Activating Factor; Glia-activating factor; HBFG 9; HBFG9; HBGF-9; Heparin-binding growth factor 9; MGC119914; MGC119915; SYNS3
Species
Homo sapiens (Human)
Expression Region
1-208aa
Target Protein Sequence
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB,220mM Sucrose , 0.02% Tween 80 , pH 6.0.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
FGF9 plays a critical role in neuronal survival, lung development, and mesenchymal cell proliferation, making it a key tool for dissecting FGF receptor signaling pathways. This tag-free, full-length recombinant human FGF9 (aa 1–208) demonstrates strong mitogenic potency, with an ED50 of 1–5 ng/mL in a Balb/3T3 fibroblast proliferation assay, supporting use in cell proliferation and survival assays, neuronal or osteogenic differentiation studies, and angiogenesis or wound healing models. Produced in *E. coli*, the protein lacks eukaryotic glycosylation—an advantage when researchers need to isolate FGF9–FGFR binding kinetics from glycan-mediated effects in SPR or ELISA-based receptor-ligand competition assays. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for sensitive cell-based experiments and provides a suitable basis for use as an ELISA standard or in *in vivo* tumor biology models.