Abbreviation
Recombinant Human CLDN6 protein-VLPs (Active)
Purity
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA1HU). The EC50 is 1.334-1.504 ng/mL.The VLPs (CSB-MP3838) is negative control.
②Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL can bind Anti-CLDN6 recombinant antibody(CSB-RA005508MA2HU). The EC50 is 2.920-3.812 ng/mL.The VLPs (CSB-MP3838) is negative control.
③Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA3HU). The EC50 is 3.482-4.097 ng/mL.The VLPs (CSB-MP3838) is negative control.
④Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL can bind Anti-CLDN6 recombinant antibody(CSB-RA005508MA4HU). The EC50 is 2.866-3.739 ng/mL.The VLPs (CSB-MP3838) is negative control.
Alternative Names
(Skullin)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
1-220aa
Target Protein Sequence
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
"The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20℃/-80℃ upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant)."
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
The presence of VLP-like structures was confirmed by TEM
-
Human CLDN6 Monoclonal Antibody (CSB-RA005508MA1HU) captured on Protein A Chip can bind Human CLDN6 Full Length VLP Protein with an affinity constant of 6.58 nM as detected by MetaSPR Assay (WeSPRTM 200).
-
The purity of VLPs was greater than 95% as determined by SEC-HPLC
-
CSB-MP005508HU(A4) is detected by Mouse anti-6*His monoclonal antibody.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/ml can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA1HU). The EC50 is 1.334-1.504 ng/mL.The VLPs (CSB-MP3838) is negative control.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/ml can bind Anti-CLDN6 recombinant antibody(CSB-RA005508MA2HU). The EC50 is 2.920-3.812 ng/mL.The VLPs (CSB-MP3838) is negative control.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/ml can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA3HU). The EC50 is 3.482-4.097 ng/mL.The VLPs (CSB-MP3838) is negative control.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/ml can bind Anti-CLDN6 recombinant antibody(CSB-RA005508MA4HU). The EC50 is 2.866-3.739 ng/mL.The VLPs (CSB-MP3838) is negative control.
Description
Claudin-6 is a tight junction protein aberrantly expressed in multiple tumor types, making it a high-priority target for therapeutic antibody development and cancer immunotherapy research. This full-length human CLDN6 (aa 1–220) is presented on virus-like particles to preserve native transmembrane topology and conformational epitopes—a critical advantage for multi-pass membrane proteins that lose proper folding when produced as soluble fragments. Functional ELISA demonstrates robust binding to multiple anti-CLDN6 recombinant antibodies with EC50 values ranging from 1.334 to 4.097 ng/mL, with empty VLPs serving as negative controls, confirming that binding is antigen-specific and supports antibody screening, epitope binning, and therapeutic candidate validation. Purity exceeding 95% by SEC-HPLC combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based tumor metastasis assays and integrin-ligand interaction studies where endotoxin interference must be minimized.
-TEM1.jpg)
-AC5.jpg)
-HPLC.jpg)
-WB.jpg)
-AC1.jpg)
-AC2.jpg)
-AC3.jpg)
-AC4.jpg)
.svg)
