Home
Product
Protein
Active Protein
Other
Recombinant Human Carbonic anhydrase 4 (CA4), partial (Active)

Recombinant Human Carbonic anhydrase 4 (CA4), partial (Active)

In Stock Discontinued

Code: CSB-AP005631HU

Rate （N/A）
Review （0）

Size:

10μg50μg500μg1mg(1mg*1 or 500ug*2)

US$195

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: C-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The esterase activity is determined to be greater than 500 pmol/min/ug

Target Names

CA4

Uniprot NO.

P22748

Research Area

Neuroscience

Alternative Names

CA IV; CA4; CAH4_HUMAN; CAIV ; Car4 ; Carbonate dehydratase IV; Carbonic anhydrase 4; Carbonic dehydratase; Carbonic dehydratase IV ; EC 4.2.1.1; Retinitis pigmentosa 17 (autosomal dominant); RP17

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

19-283aa

Target Protein Sequence

AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

31.43 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.5

Storage

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Lead Time

Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Shelf Life

The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Reversible hydration of carbon dioxide. May stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It is essential for acid overload removal from the retina and retina epithelium, and acid release in the choriocapillaris in the choroid.

Gene References into Functions

CA4 is a novel tumour suppressor in Colorectal cancer through the inhibition of the Wnt signalling pathway by targeting the WTAP-WT1-TBL1 axis. CA4 methylation may serve as an independent biomarker for the recurrence of Colorectal cancer . PMID:26071132
Carbonic anhydrase 4 is lost in papillary thyroid carcinoma but not thyroid nodules PMID:24880201
Although CA IV has been shown to be active in mediating CO2 and HCO3 (-) transport in many important tissues like kidney and lung, and in isolated cells from brain and muscle, the gene for CA IV appears not to be essential. PMID:24146379
Coexpression of CAIV with MCT1 and MCT4 resulted in a significant increase in MCT transport activity. PMID:24338019
membrane-associated CA IV contributes robust catalytic activity intracellularly, and this activity participates in regulating H(+) dynamics in the cytosol PMID:23297198
Two SNPs of carbonic anhydrase IV, which are responsible for amino acid changes, were found. The frequencies of these SNPs were not significantly different between the caries-free group and the group with caries PMID:22021688
compared the subcellular localization and post-translational processing of wild-type (WT)- and retinitis pigmentosa 17 mutant-CAIV in three cell types PMID:20626030
The results suggest that the expression level of carbonic anhydrase IV may be important to maintain retina function in retinitis pigmentosa. PMID:20450258
renal injury inflicted by expression of human carbonic anhydrase IV folding mutants was markedly enhanced by haploinsufficiency of the endoplasmic reticulum cochaperone p58(IPK). PMID:20308551
binding by extracellular loop 4 of the human AE1 Cl-/HCO3- exchanger PMID:11994299
carbonic anhydrase IV binds EC4 of NBC1, and this interaction is essential for full NBC1 activity PMID:14567693
mutation was found to cosegregate with the retinitis pigmentosa RP17 phenotype in two large families PMID:15090652
CA inhibitors may have long-term adverse effects on vision. PMID:15563508
characterized the CA IV expressed in Capan-1 cells PMID:17409381
A novel mutation has been identified in CA4 that provides further evidence that impaired pH regulation may underlie photoreceptor degeneration in retinitis pigmentosa PMID:17652713
CAIV p.R14W sequence variant found in one of the patients with Bothnia dystrophy phenotype is benign polymorphism in population of northern Sweden. PMID:18344446
Apoptosis induced by the CA IV mutants could be prevented, at least partially, by treating the cells with dorzolamide, a CA inhibitor PMID:19211803