Recombinant Human CD70 antigen (CD70), partial (Active)

CSB-MP004954HU1
Size:
20ug
20ug100ug1mg
US$138
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Purity
Greater than 92.5% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human CD70 at 2 μg/mL can bind Anti-CD70 antibody, the EC50 is 2.414-3.196 ng/mL.
Target Names
CD70
Uniprot NO.
Research Area
immunity
Alternative Names
(CD27 ligand) (CD27-L)(CD27L)(CD27LG)(TNFSF7)
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
52-193aa
Target Protein Sequence
SLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Mol. Weight
22.7 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced/non-reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CD70 at 2 μg/ml can bind Anti-CD70 antibody, the EC50 is 2.414-3.196 ng/mL.
Description

The synthesis of the recombinant human CD70 protein involves gene cloning, plasmid assembly, protein expression, purification, and analysis. The gene sequence encoding amino acids 52-193 of the human CD70 is co-inserted into a plasmid with an N-terminal 10xHis-tag gene. The plasmid is transfected into mammalian cells, and a selective antibiotic is introduced to screen the transfected cells. The selected cells are cultured for protein expression, and the CD70 protein is released by lysing the cells and then purified via Ni-NTA affinity chromatography. SDS-PAGE confirms a purity level of the recombinant CD70 greater than 92.5%, and the LAL method verifies endotoxin content below 1.0 EU/μg. The CD70 protein's activity is validated through ELISA, in which it binds to the CD70 antibody with an EC50 of 2.414-3.196 ng/mL.

The human CD70 antigen is a member of the TNF superfamily, primarily expressed on activated lymphocytes and certain tumor cells. CD70 interacts with its receptor CD27, which is crucial for T-cell activation, proliferation, and survival, thereby influencing immune responses against tumors [3][10].

CD70 expression is notably upregulated in various malignancies, including renal cell carcinoma (RCC), melanoma, and glioblastoma, among others. Elevated expression of CD70 is often associated with aggressive tumor behavior and poor prognosis [6][8][9]. Studies have shown that CD70 is expressed in approximately 30% to 68% of clear cell RCC cases and is linked to hematogenous metastases in pancreatic cancer [1][8]. The presence of CD70 in these tumors suggests its involvement in promoting tumor growth and immune evasion, as it can induce apoptosis in T-cells and B-cells, thereby facilitating tumor progression [6].

CD70's restricted expression pattern—being largely absent in normal tissues—makes it an attractive target for immunotherapy. Several therapeutic strategies are being explored, including monoclonal antibodies and antibody-drug conjugates (ADCs) targeting CD70. These approaches aim to harness the immune system to selectively destroy CD70-expressing tumor cells while minimizing damage to normal cells [2][4][5]. For example, the humanized antibody SGN-70 has shown promising antitumor activity in preclinical models, highlighting the potential of CD70-targeted therapies in treating malignancies [7].

References:
[1] Flieswasser, T., Camara-Clayette, V., Danu, A., Bosq, J., Ribrag, V., Zabrocki, P., … & Jacobs, J. (2019). Screening a broad range of solid and haematological tumour types for cd70 expression using a uniform ihc methodology as potential patient stratification method. Cancers, 11(10), 1611. https://doi.org/10.3390/cancers11101611
[2] Hagemann, U., Mihaylova, D., Uran, S., Borrebaek, J., Grant, D., Bjerke, R., … & Cuthbertson, A. (2017). Targeted alpha therapy using a novel cd70 targeted thorium-227 conjugate inin vitroandin vivomodels of renal cell carcinoma. Oncotarget, 8(34), 56311-56326. https://doi.org/10.18632/oncotarget.16910
[3] Jacobs, J., Zwaenepoel, K., Rolfo, C., Bossche, J., Deben, C., Silence, K., … & Pauwels, P. (2015). Unlocking the potential of cd70 as a novel immunotherapeutic target for non-small cell lung cancer. Oncotarget, 6(15), 13462-13475. https://doi.org/10.18632/oncotarget.3880
[4] Jeffrey, S., Burke, P., Lyon, R., Meyer, D., Sussman, D., Anderson, M., … & Senter, P. (2013). A potent anti-cd70 antibody–drug conjugate combining a dimeric pyrrolobenzodiazepine drug with site-specific conjugation technology. Bioconjugate Chemistry, 24(7), 1256-1263. https://doi.org/10.1021/bc400217g
[5] Jilaveanu, L., Sznol, J., Aziz, S., Duchen, D., Kluger, H., & Camp, R. (2012). Cd70 expression patterns in renal cell carcinoma. Human Pathology, 43(9), 1394-1399. https://doi.org/10.1016/j.humpath.2011.10.014
[6] Liu, N., Sheng, X., Liu, Y., & Yu, J. (2013). Increased cd70 expression is associated with clinical resistance to cisplatin-based chemotherapy and poor survival in advanced ovarian carcinomas. Oncotargets and Therapy, 615. https://doi.org/10.2147/ott.s44445
[7] McEarchern, J., Smith, L., McDonagh, C., Klussman, K., Gordon, K., Morris-Tilden, C., … & Law, C. (2008). Preclinical characterization of sgn-70, a humanized antibody directed against cd70. Clinical Cancer Research, 14(23), 7763-7772. https://doi.org/10.1158/1078-0432.ccr-08-0493
[8] Nakamura, K., Sho, M., Akahori, T., Nishiwada, S., Kunishige, T., Nakagawa, K., … & Ikeda, N. (2021). Clinical relevance of cd70 expression in resected pancreatic cancer: prognostic value and therapeutic potential. Pancreatology, 21(3), 573-580. https://doi.org/10.1016/j.pan.2021.01.013
[9] Pich-Bavastro, C., Sarrabayrouse, G., Teiti, I., Mariamé, B., Rochaix, P., Lamant, L., … & Tilkin–Mariamé, A. (2015). Melanoma-expressed cd70 is involved in invasion and metastasis. British Journal of Cancer, 114(1), 63-70. https://doi.org/10.1038/bjc.2015.412
[10] Shaffer, D., Savoldo, B., Yi, Z., Chow, K., Kakarla, S., Spencer, D., … & Gottschalk, S. (2011). T cells redirected against cd70 for the immunotherapy of cd70-positive malignancies. Blood, 117(16), 4304-4314. https://doi.org/10.1182/blood-2010-04-278218

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Cytokine which is the ligand for CD27. The CD70-CD27 pathway plays an important role in the generation and maintenance of T cell immunity, in particular during antiviral responses. Upon CD27 binding, induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
Gene References into Functions
  1. This dose-escalation phase I trial provides evidence of good tolerability of ARGX-110, pharmacokinetics, and preliminary antitumor activity at all dose levels in generally heavily pretreated patients with advanced CD70-positive malignancies PMID:28765328
  2. Results show that CD70 promoter region methylation and expression are regulated by MBD4. Indeed, the study shows that downregulation of MBD4 contributed to overexpression and hypomethylation of the CD70 gene in CD4+ T cells from patients from systemic lupus erythematosus. PMID:29018507
  3. CD70 mitigates atherosclerosis at least in part by modulating macrophage function. PMID:27786334
  4. This study demonstrated that Expression of CD70 (CD27L) Is Associated With Epithelioid and Sarcomatous Features in IDH-Wild-Type Glioblastoma. PMID:28789475
  5. CD27 is engaged by CD70 cross-presented by other AML blasts or stem/progenitor cells in a paracrine manner. PMID:28031480
  6. human CD70-CD27 interactions therefore play a nonredundant role in T and B cell-mediated immunity, especially for protection against EBV and humoral immunity. PMID:28011864
  7. These data demonstrate the important role of the CD70/CD27 axis in immune responses in HTLV-1 carriers and ATL patients. PMID:26077361
  8. CD70: An emerging target in cancer immunotherapy PMID:26213107
  9. Both monomeric and trimeric forms of CD70 were detected in tumour cell membrane fractions, whereas cytoplasmic fractions contained almost exclusively monomeric CD70 PMID:26671750
  10. CD70 is overexpressed in systemic lupus erythematosus CD4+ T cells, but expression is not linked to the typical clinical and serological parameters associated with the disease. PMID:24238281
  11. CD70-blocking of alphaDC1s from both controls and patients with chronic lymphocytic leukaemia had a negative influence on the production of both IL-12p70 and the Th1 cytokine IFN-gamma. PMID:24684541
  12. CD70 acts as a functional receptor binding to soluble CD27, resulting in lymphoma progression and that immunotherapy using anti-CD70 antibody may be a potential candidate for treatment for NNKTL. PMID:23206232
  13. The mean expression of CD70 was almost twice as high in renal cell carcinoma relative to normal kidney tissue PMID:22401771
  14. Regulation of Langerhans cell CD70 expression is important in enhancing immunity against cutaneous epithelial pathogens and cancer. PMID:22377764
  15. Findings suggest that demethylation of CD70 promoter region contributes to the overexpression of CD70 in CD4+ T cells and may contribute to autoimmune response in systemic sclerosis (SSc). PMID:22306512
  16. These findings indicate that aberrant histone modifications within the TNFSF7 promoter may contribute to the development of lupus by increasing CD70 expression in CD4(+) T cells. PMID:21865261
  17. CD70 and CD11a facilitate the survival of T and B lymphocytes and indirectly enhance the destruction of platelets in immune thrombocytopenia. PMID:21541792
  18. data indicate that the virus-induced selective upregulation of CD70 by Langerhans cells is the critical feature that enhances their capacity to induce effector CD8+ T cell responses compared with virus-primed dermal dendritic cells that lack CD70 PMID:21880979
  19. concluded DNA methyltransferases(DNMTs) functioned as demethylases as MBD2, while increased DNMTs and MBD2 may cause demethylation and over expression of CD70 in CD4(+) T cells, potentially contributing to the pathogenesis of immune thrombocytopenia PMID:21550117
  20. Th1 cell-specific CD70 expression may be involved in an amplification loop for polarized Th1-type immune responses through T cell-T cell interactions. PMID:21490618
  21. Stimulation of T cells expressing CD70-specific chimeric antigen receptors resulted in CD27 costimulation and recognition of CD70-positive tumor cell lines and primary tumor cells, as shown by IFN-gamma and IL-2 secretion and by tumor cell killing. PMID:21304103
  22. RFX1 recruits SUV39H1 to the promoter regions of the CD11a and CD70 genes in CD4(+) T cells, thereby regulating local H3K9 tri-methylation levels. PMID:21192791
  23. In this review, CD27 and CD70 constitute a unique pair ligand and receptor pair which can activate innate and adaptive immunity as well as regulate immunity versus tolerance. PMID:20699361
  24. CD70 expression was significantly elevated and correlated with a decrease in CD70 promoter methylation in T4 lymphocytes from Sjogren's syndrome patients as compared to levels in controls. PMID:20724115
  25. Epigenetic silencing of the TNFSF7 gene via hypermethylation of its proximal region may allow the benign and invasive MCF10 variants to escape immune surveillance. PMID:20119871
  26. the CD70-CD27 interaction may play an important role in inducing effective immune responses in dendritic cell-based immunotherapy. PMID:20201989
  27. CD70 is an important factor in the regulation of B-cell growth and differentiation by plasmacytoid dendritic cells. PMID:20139096
  28. Data confirm previous observations of higher expression of CD70 in CD4+ T cells from patients with SLE, and suggest that increased Fyn protein content in CD4+ T cells can be associated with high SLE disease activity. PMID:19955046
  29. Identification of CD70-mediated apoptosis of immune effector cells as a novel immune escape pathway of human glioblastoma PMID:11980654
  30. intragraft gene expression is not a risk factor for acute cardiac allograft rejection PMID:12009595
  31. Systemic lupus erythematosus T cells and T cells treated with DNA methyltransferase inhibitors and ERK pathway inhibitors overexpress CD70. PMID:15188362
  32. Immunocytochemical analysis demonstrated that binding of an anti-CD70 antibody to CD70(TNFSF7), endogenously expressed on the surface of A498 and 786-O cell lines resulted in the rapid internalisation of the antibody-receptor complex. PMID:16892042
  33. Apoptosis mediated by exposure to the CD70 secreted by tumor cells may contribute to the failure of renal cell carcinoma patients to develop an effective lymphocyte-mediated antitumor response PMID:17132225
  34. reveal a novel role for non-Hodgkin lymphoma B cells in the development of intratumoral regulatory T cells PMID:17615291
  35. CD27-CD70 interactions in the pathogenesis of Waldenstrom macroglobulinemia. PMID:18216294
  36. CD70 gene was upregulated more than 1,000-fold and the enhanced expression of the CD70 molecule was confirmed by laser flow cytometry for various HTLV-1-carrying T-cell lines and primary CD4(+) T cells isolated from acute-type ATL patients. PMID:18256142
  37. Dendritic cells matured in the presence of PGE(2) induced the expression of OX40, OX40L, and CD70 on T cells facilitating T-cell/T-cell interaction that warrant long-lasting costimulation. PMID:19029446
  38. CD70 not only contributes to the activation of cytotoxic T cells in B cell precursor acute lymphoblastic leukemia but is a critical signal during the expansion phase of the cytotoxic T cell response. PMID:19109206
  39. Constitutive expression of CD70 transgene is sufficient to deregulate the CD8 T cell differentiation pathway of acute infection reminiscent of events in chronic infection. PMID:19380782
  40. Data showed that the CD70, perforin and KIR2DL4 promoters are demethylated in CD4(+)CD28(-) T cells, and that DNA methyltransferase 1 (Dnmt1) and Dnmt3a levels are decreased in this subset. PMID:19394279

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Protein Families
Tumor necrosis factor family
Database Links

HGNC: 11937

UNIGENE: Hs.501497

KEGG: hsa:970

STRING: 9606.ENSP00000245903

OMIM: 602840

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products