Abbreviation
Recombinant Human IL22 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL-22 (E. Coli) at 2μg/ml can bind Recombinant Human IL-22RA2 (C-Fc), the ED50 of Recombinant Human IL-22RA2 (C-Fc) is 34.43 ng/ml.
Alternative Names
Cytokine Zcyto18; IL 10 related T cell derived inducible factor; IL 21; IL 22; IL D110; IL TIF; IL-10-related T-cell-derived-inducible factor; IL-22; IL-TIF; IL21; Il22; IL22_HUMAN; ILD110; ILTIF; Interleukin 10 related T cell derived inducible factor; interleukin 21; Interleukin 22; Interleukin-22; MGC79382; MGC79384; TIFa; TIFIL 23; TIFIL23; UNQ3099/PRO10096; zcyto18
Species
Homo sapiens (Human)
Expression Region
34-179aa
Target Protein Sequence
APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20mM Histidine-HCl, 6% Sucrose, 4% Mannitol, 0.05% Tween 80, pH 5.5.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
IL-22 signals through the IL-22R1/IL-10R2 heterodimer to activate JAK/STAT3 pathways critical for epithelial barrier defense and tissue repair, making a well-characterized recombinant form essential for dissecting these mechanisms. This tag-free human IL-22 (aa 34–179) encompasses the mature secreted sequence and demonstrates confirmed receptor engagement, with an ED50 of 34.43 ng/ml for binding recombinant human IL-22RA2 in functional ELISA—supporting its use as a coating antigen for antibody screening, a positive control in cytokine detection assays, and a ligand in JAK/STAT signaling studies. The endotoxin level below 1.0 EU/μg satisfies the stringent criteria needed to prevent LPS-driven artifacts in cell-based activation or differentiation assays and in vivo inflammation models. Purity exceeding 95% by SDS-PAGE, combined with this low endotoxin burden, provides a suitable basis for generating reliable dose-response data in STAT3 phosphorylation readouts and antibody validation workflows.