Abbreviation
Recombinant Human TGFB2 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 cells is 30-180pg/ml.
Alternative Names
BSC-1 cell growth inhibitor; BSC1 cell growth inhibitor; Cetermin; G-TSF; Glioblastoma-derived T-cell suppressor factor; GTSF; LAP; Latency-associated peptide; MGC116892; MGF; Milk growth factor; Polyergin; TGF-beta-2; TGF-beta2; TGFB2; TGFB2_HUMAN; Transforming growth factor beta 2
Species
Homo sapiens (Human)
Expression Region
303-414aa
Target Protein Sequence
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm Filtered 4 mM HCl
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
TGF-β2 plays a central role in immunosuppression and tumor microenvironment remodeling, making it a critical tool for dissecting glioblastoma biology and broader cancer signaling. This tag-free recombinant human TGFB2 encompasses the mature signaling domain (aa 303–414) and demonstrates potent bioactivity, with an ED50 of 30–180 pg/mL in inhibiting IL-4-dependent TF-1 cell proliferation — a level of receptor-binding potency that supports use in cell proliferation assays, stem cell or neuronal differentiation studies, and in vivo tumor biology models. Mammalian cell expression preserves native-like glycosylation and disulfide bonding essential for proper TGF-β2 folding and receptor engagement, providing a suitable basis for receptor-ligand binding experiments such as SPR and competition ELISA, as well as antibody characterization workflows. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the quality criteria typical for cell-based bioassays and sensitive in vivo studies.