Abbreviation
Recombinant Human FGF4 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using MCF7 Human breast cancer cells is 2-20 ng/ml.
Research Area
Signal Transduction
Alternative Names
FGF-4; Fgf4; FGF4_HUMAN; Fibroblast growth factor 4; fibroblast growth factor 4 splice isoform; HBGF-4; HBGF4; Heparin secretory-transforming protein 1; Heparin-binding growth factor 4; Hst; HST-1; HST1; HSTF-1; HSTF1; Human stomach cancer transforming factor from FGF related oncogene; K FGF; Kaposi Sarcoma Oncogene; KFGF; KS3; Oncogene HST; Transforming protein KS3
Species
Homo sapiens (Human)
Expression Region
54-206aa
Target Protein Sequence
SLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 500mM NaCl, pH7.4.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
FGF4 drives mitogenic signaling through FGFR complexes and plays critical roles in embryonic development, angiogenesis, and tumor progression. This tag-free recombinant human FGF4 (residues 54–206) covers the mature secreted form and demonstrates potent bioactivity with an ED50 of 2–20 ng/ml in MCF7 cell proliferation assays, confirming receptor-binding competence suitable for cell survival studies, angiogenesis models, and stem cell differentiation experiments. Produced in *E. coli*, the protein lacks glycosylation, making it appropriate for receptor-ligand binding and competition assays—such as SPR or ELISA—where consistent, homogeneous preparations are essential for quantitative reproducibility. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for sensitive cell-based assays and supports use in tumor biology models or as a reliable standard in antibody characterization workflows.
