Recombinant Human Fibroblast growth factor 19 (FGF19), partial (Active)

In Stock Discontinued
Code: CSB-AP003911HU
Size:
10μg
10μg50μg500μg1mg(1mg*1 or 500ug*2)
US$137
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to bind Human FGF R3 in functional ELISA is less than 15 ug/ml.
Uniprot NO.
Research Area
Signal Transduction
Alternative Names
FGF 19; FGF-19; FGF15; FGF19; FGF19_HUMAN; Fibroblast growth factor 15; Fibroblast growth factor 19
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
27-216aa
Target Protein Sequence
FSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.5 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4.
Gene References into Functions
  1. Study showed that FGF19 amplification is a genetic event in Chinese lung squamous cell carcinoma (LSCC) patients, with a frequency of 37.5%. FGF19 amplified LSCC cells express relatively higher levels of FGF19 mRNA expression, and downregulation of FGF19 expression can induce significant cell killing effects in vitro and in vivo. PMID:28906590
  2. FGFR4/FGF19 autocrine signaling mediates the survival of a subset of basal-like breast cancer cells PMID:27192118
  3. FGF19 copy number may increase in hepatocellular carcinoma accompanying a complete response to sorafenib treatment PMID:27384874
  4. Study demonstrates that elevated FGF19 expression or hyperactivation of FGF19/FGFR4 signaling in hepatocellular carcinoma cells is one of the main mechanisms of sorafenib resistance. PMID:28069043
  5. This is the first study to elucidate FGF19/FGFR4 signaling in favor of hepatocellular carcinoma cells developing from fatty liver PMID:27447573
  6. High expression of FGF19 is associated with hepatocellular carcinoma. PMID:26498355
  7. Findings show that FGF19 provides a cytoprotective role against ER stress by activating a FGFR4-GSK3beta-Nrf2 signaling cascade, suggesting targeting this signaling node as a candidate therapeutic regimen for hepatocellular carcinoma (HCC) management. PMID:28951455
  8. Fibroblast growth factor 19 levels in human portal blood are higher than in arterial blood. Fibroblast growth factor 19 is released by the portal-drained viscera under fasted steady state conditions. PMID:28003563
  9. Intestinal sensing of highly elevated levels of conjugated bile acids in blood promotes FGF15/FGF19 signaling, reducing hepatic bile acid synthesis and modulating bile acid transporters. PMID:28498614
  10. serum FGF19 and FGF21 and hepatic Klotho expression are inversely associated with hepatic damage in children with NAFLD PMID:23840612
  11. Administering FGF19, or suitable mimetic, as a pharmacological intervention to increase circulating levels of FGF19 and suppress BA synthesis by inhibiting CYP7A1 gene expression is likely to provide therapeutic benefits for many PBC patients PMID:28570655
  12. Amplification of FGF19 was validated in independent LSCC samples. Furthermore, FGF19 stimulated LSCC cell growth in vitro. These data implicate FGF19 as a potential driver gene in LSCC with clinic characteristics as smoking. PMID:26943773
  13. FGF19 is able to enhance migration and invasion abilities of gastric cancer cells. PMID:27053348
  14. Bile acid and FGF19 levels increased after Roux-en-Y bypass, but not after intensive medial management in type 2 diabetic subjects who achieved similar improvement in glycemic control. PMID:26259981
  15. FGF19 correlates with severity of liver disease and can potentially serve as an indicator of chronic cholestatic liver injury. PMID:26293907
  16. Study shows that FGF19 can be secreted and promotes ovarian cancer progression such as proliferation and invasion by activating FGFR4. PMID:26323668
  17. we suggest that considerable mechanistic differences exist between humans and mice with regard to the nuclear receptors controlling the VitA-FGF15/19 axis. PMID:26723851
  18. Suggest a potential connection between gallbladder cholangiocyte-derived FGF19 and bile acid metabolism that could lead to metabolic dysregulation following cholecystectomy. PMID:26256900
  19. discusses current knowledge of the complex biology of the endocrine FGFs. PMID:26567701
  20. FGF-19 increment after OGL was positively associated with age, and negatively associated with abnormal glucose regulation and statin treatment PMID:26343925
  21. KL methylation is a characteristic of many breast cancer cases . However, the resulting or associated perturbation in FGFR4 expression, similar to FGF19, could be utilized as a biomarker for poor prognosis PMID:26152288
  22. The pathogenesis of intestinal failure associated liver disease is uncertain, we therefore investigated the role of FGF19 and pro-inflammatory cytokines has on this disease state. PMID:25595885
  23. In this review, we have reported the altered expression of FGF19 in non-alcoholic fatty liver disease and hepatocellular carcinoma; we find limited information on the role of FGF19 in other liver diseases PMID:25547779
  24. In mice with humanized livers, expression of an FGF19 transgene corrects bile acid signaling defects, resulting in normalization of bile acid synthesis, the bile acid pool, and liver size. PMID:26028580
  25. The data suggest that FGF19/FGF21 circulating levels and hepatic gene expression of the associated signaling pathway are significantly dysregulated in type 2 diabetes. PMID:25664662
  26. Describe a nontumorigenic FGF19 variant, M70, which regulates bile acid metabolism and, through inhibition of bile acid synthesis/reduction of excess hepatic bile acid accumulation, protects mice from cholestatic liver injury. PMID:25080475
  27. obesity appears as the predominant determinant of the abnormalities in FGF21 and FGF19 levels. Opposite changes in beta-Klotho expression in fat and liver indicate potential tissue-specific alterations in the responsiveness to endocrine FGFs in obesity PMID:24813368
  28. FGF19 levels were reduced in non-diabetic obese subjects as compared to lean controls and obese type 2 diabetic subjects. PMID:24841294
  29. Fibroblast growth factor 19 might be associated with biochemical recurrence after radical prostatectomy by promoting cell proliferation and epithelial-mesenchymal transition of prostate cancer PMID:25854696
  30. In hepatocellular carcinoma, FGF19 amplifications, known to activate Wnt signaling, were mutually exclusive with CTNNB1 and AXIN1 mutations, and significantly associated with cirrhosis. PMID:24798001
  31. FGF19 expression is not associated with lymph node metastasis and locally invasive characteristics of the tumor in colorectal cancers PMID:23803094
  32. Reduced fibroblast growth factor 19 is a feature of bile acid diarrhea. PMID:23981126
  33. [review] While FGF19 is a negative feedback regulator of bile acid metabolism and can circulate as a hormone, emerging evidence has showed its autocrine or exocrine function. PMID:24827712
  34. FGF19 stimulates tumor progression by activating the STAT3 pathway. PMID:24728076
  35. Reduced serum FGF19 levels could be involved in the pathophysiology of gestational diabetes mellitus, while increased serum FGF21 levels could be a compensatory response to this disease. PMID:24260557
  36. Quantification of FGF19 expression appears to provide valuable prognostic information in breast cancer PMID:24248542
  37. Fasting serum FGF19 levels were decreased in Chinese subjects with IFG and inversely associated with fasting glucose levels. PMID:23628619
  38. These results suggest that SREBP-2 negatively regulates the FXR-mediated transcriptional activation of the FGF19 gene in human intestinal cells. PMID:24321096
  39. Serum FGF19 is associated with the presence and severity of coronary artery disease in a Chinese population. PMID:23940810
  40. The specificity of hFGF19 signaling is greatly altered in a mouse model system. PMID:23064887
  41. FGF19 protein expression might be an effective predictor of early recurrence and a marker for poor prognosis of hepatocellular carcinoma. PMID:23456506
  42. FGF19 (fibroblast growth factor 19) as a novel target gene for activating transcription factor 4 in response to endoplasmic reticulum stress PMID:23205607
  43. A decrease in fasting FGF19 levels is associated with the development of non-alcoholic fatty liver disease in obese adolescents. PMID:23329754
  44. HNF4alpha and LRH-1 promote active transcription histone marks on the Cyp7a1 promoter that are reversed by FGF19 in a SHP-dependent manner PMID:23038264
  45. These results suggest that FGF19 is transcriptionally activated through multiple Farnesoid X receptor-responsive elements in the promoter region PMID:22561792
  46. Differential specificity of endocrine FGF19 and FGF21 to FGFR1 and FGFR4 in complex with KLB. PMID:22442730
  47. The FGF19 effect on APOA was attenuated by transfection of primary hepatocytes with siRNA against the FGF19 receptor 4 (FGFR4). PMID:22267484
  48. Baseline serum FGF-19 levels are significantly lower in obese patients with type 2 diabetes and is at least partially dependent upon nutritional status, but is not related to glucose metabolism or insulin sensitivity parameters. PMID:21574752
  49. Mouse Fgf15 and human FGF19 play key roles in enterohepatic signaling, regulation of liver bile acid biosynthesis, gallbladder motility and metabolic homeostasis PMID:22396169
  50. FGF-19 levels are low in type 2 diabetic patients with metabolic syndrome. PMID:22166511

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Heparin-binding growth factors family
Tissue Specificity
Expressed in fetal brain, cartilage, retina, and adult gall bladder.
Database Links

HGNC: 3675

UNIGENE: Hs.249200

KEGG: hsa:9965

STRING: 9606.ENSP00000294312

OMIM: 603891

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products