Home
Product
Protein
Active Protein
Tumor Necrosis Factor
Recombinant Mouse Tumor necrosis factor receptor superfamily member 10B (Tnfrsf10b), partial (Active)

Recombinant Mouse Tumor necrosis factor receptor superfamily member 10B (Tnfrsf10b), partial (Active)

In Stock

Code: CSB-AP005041MO

Rate （N/A）
Review （0）

Size:

10ug50ug500ug1mg

US$184

Quantity:

Express system: Mammalian cell

Species: Mus musculus (Mouse)

Tag Info: C-terminal hFc-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Mouse Tnfrsf10b protein, partial (Active)

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is 92.04 ng/ml in the presence of 40 ng/mL of TNFSF10.

Uniprot NO.

Q9QZM4

Research Area

Cancer

Alternative Names

Tnfrsf10b; Dr5; Killer; Tumor necrosis factor receptor superfamily member 10B; Death receptor 5; MK; CD antigen CD262

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

53-177aa

Target Protein Sequence

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

40.9 kDa

Protein Length

Partial

Tag Info

C-terminal hFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

TNFRSF10B (DR5/Killer) serves as a critical death receptor in TRAIL-mediated apoptosis, making it a key target in cancer biology and therapeutic antibody development. This recombinant mouse Fc-tagged construct covers the extracellular ligand-binding domain (aa 53–177) and demonstrates functional activity with an ED50 of 92.04 ng/mL in inhibiting TRAIL-mediated cytotoxicity in L-929 fibroblasts at 40 ng/mL TNFSF10, confirming its suitability for competitive inhibition assays, blocking antibody screening, and ligand-binding interaction studies via ELISA, SPR, or BLI. Mammalian cell expression preserves native glycosylation and proper disulfide-mediated folding of the cysteine-rich extracellular domain, supporting conformational integrity essential for epitope mapping and small-molecule or biologic inhibitor screening in drug discovery workflows. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the quality criteria typical for cell-based functional assays and affinity characterization experiments.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.

Gene References into Functions

Death receptor5 pathway and mitochondrial pathway, which are likely mediated by HIF-1alpha, contribute to hypoxia-induced spermatocyte apoptosis. PMID:28444885
downregulation of cIAPs in PSC cholangiocytes may contribute to the development of the disease. Our results also indicate that inhibition of TRAIL signaling pathways may be beneficial in the treatment of PSC PMID:28055006
Authors demonstrate, for the first time, expression of TNF-related apoptosis-inducing ligand (TRAIL) and its signaling death receptor 5 (DR5) in the murine inner ear. PMID:26791792
Malignant transformation in the endometrium is related to reduction of membrane DR4 and DR5 expression. PMID:23815209
TRAIL expression by osteoclast-like cells is increased in the presence of RANKL and after scraping; DcR2 expression peaks at 24 hours, and and decreases at 5 days; DR5 expression peaks at 5 days PMID:23430714
Induction of death receptor 5 expression in tumor vasculature by perifosine restores the vascular disruption activity of TRAIL-expressing CD34(+) cells. PMID:23605004
TRAIL-DR5 interaction promoted malignant behaviors of B16F10 cells. PMID:23347256
results suggest that the transmembrane domains together with their adjacent stalk regions can play a major role in control of death receptor activation thereby contributing to cell type specific differences in TRAILR1 and TRAILR2 signaling PMID:22916132
DR5 is selectively expressed by neuroprogenitor cells and newborn neurons. PMID:21938487
Results suggest that excessive iodine could induce TRAIL and DR5 abnormal expression in thyroid. TRAIL band with DR5 to promote follicular cells apoptosis thus mediate thyroid destruction in EAT. PMID:21225479
NK cells inhibit dendritic cell cross-priming, but not direct priming, in a TRAIL/DR5-dependent manner. PMID:21832159
Antibody-based therapy targeting DR5 is an efficient strategy not only to eliminate TRAIL-sensitive tumor cells. PMID:14769851
presence and function of TRAIL and MK, a death-inducing ligand and its receptor, in mammalian preimplantation embryos. PMID:15128592
binding of Fas-associated death domain (FADD) to the tumor necrosis factor-related apoptosis-inducing ligand receptor DR5 is regulated by the death effector domain of FADD PMID:15173180
Inactivation of the TRAIL-R gene did not affect tumorigenesis in the thymus and intestines of p53 knock-out mice and mice mutated in the Adenomatous Polyposis Coli gene, respectively. PMID:15514675
DR5 has a limited role during embryogenesis and early stages of development but plays an organ-specific role in the response to DNA-damaging stimuli. PMID:15713653
ceramide acts as a common mediator of caspase-independent programmed cell death caused by death receptors such as mTRAIL-R2 and TNF-R55 PMID:17026999
These data demonstrate an important role for the TRAIL/DR5/FADD/caspase 8 pathway in the apoptosis associated with skeletal myoblast differentiation. PMID:17041756
These data represent the first indication that testicular germ cells, specifically spermatocytes, can undergo TRAIL-mediated apoptosis. PMID:17051329
Thus, sDR5 represents a potential novel therapeutic drug for patients with fulminant hepatitis. PMID:17126290
cathepsin E plays a substantial role in host defense against tumor cells through TRAIL-dependent apoptosis and/or tumor-associated macrophage-mediated cytotoxicity PMID:18006832
Thus TRAIL-R may function as an inflammation and tumor suppressor in multiple tissues in vivo. PMID:18079962
adherent TRAIL-R-expressing skin carcinoma cells were TRAIL resistant in vitro but were sensitized to TRAIL upon detachment by inactivation of the ERK signaling pathway PMID:18079967
Death receptor 5 mediated-apoptosis contributes to cholestatic liver disease. PMID:18667695
Apoptosis in experimental non-alcoholic steatohepatitis is associated with p53 activation and TRAIL receptor expression. PMID:19226377
Data demonstrate that cytokine induced upregulation of TRAIL, DR4 and DR5 in tubules from patients with proliferative lupus nephritis may play a protective role by enhancing survival while also exerting a proinflammatory effect. PMID:19349211