Home
Product
Protein
Transmembrane Proteins
Recombinant Xenopus laevis Glutamate receptor, ionotropic kainate 2 (grik2)

Recombinant Xenopus laevis Glutamate receptor, ionotropic kainate 2 (grik2)

Code: CSB-CF820942XBE

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4627

Quantity:

Express system: in vitro E.coli expression system

Species: Xenopus laevis (African clawed frog)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

grik2

Uniprot NO.

Q91755

Alternative Names

grik2; glur6; Glutamate receptor ionotropic, kainate 2; GluK2; Glutamate receptor 6; GluR-6; GluR6

Species

Xenopus laevis (African clawed frog)

Source

in vitro E.coli expression system

Expression Region

1-285

Target Protein Sequence

SELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYG AVQDGATMTFFKKSRIPTYEKMWAFMNSRSQSVLVKNNEEGIQRALTSDYAFLMESTTIE FVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGVLHMMKEKWWRGNG CPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVE ELRMSLKCQRRLKHKPQPPVIVKTEEVINMHTFNDRRLPGKETMA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist.; Independent of its ionotropic glutamate receptor activity, acts as a thermoreceptor conferring sensitivity to cold temperatures. Functions in dorsal root ganglion neurons.

Subcellular Location

Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Protein Families

Glutamate-gated ion channel (TC 1.A.10.1) family, GRIK2 subfamily

Database Links

UNIGENE: Xl.21633

Promotions