Recombinant Sistrurus miliarius NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Code: CSB-CF015079SZQ
Size:
20μg
20μg100μg
US$4223
Quantity:
Express system: in vitro E.coli expression system
Species: Sistrurus miliarius (Pigmy rattlesnake) (Crotalus miliarius)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
MT-ND4
Uniprot NO.
Alternative Names
MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Species
Sistrurus miliarius (Pigmy rattlesnake) (Crotalus miliarius)
Source
in vitro E.coli expression system
Expression Region
1-231
Target Protein Sequence
PIAGSMILAAILLKLGGYGIIRLMQIFPTTKTDVFLPFIVLALWGAILANLTCLQQTDLK SLIAYSSISHMGLVVAAIIIQTPWGLSGAMALMIAHGFTSSALFCLANTTYERTHTRILI LTRGLHNMMPMATTWWLMANLMNIAIPPSMNFTGELLILSTLFNWCPTTIIMLGLSMLIT ASYSLHMFLSTQMGPTLINNLTEPTHSREHLLMTLHLIPLLMISFKPELVT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Protein Families
Complex I subunit 4 family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products