Home
Product
Protein
Transmembrane Proteins
Recombinant Sheep Sodium/potassium-transporting ATPase subunit beta-1 (ATP1B1)

Recombinant Sheep Sodium/potassium-transporting ATPase subunit beta-1 (ATP1B1)

Code: CSB-CF002326SH

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4762

Quantity:

Express system: in vitro E.coli expression system

Species: Ovis aries (Sheep)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

ATP1B1

Uniprot NO.

P05028

Alternative Names

ATP1B1; Sodium/potassium-transporting ATPase subunit beta-1; Sodium/potassium-dependent ATPase subunit beta-1

Species

Ovis aries (Sheep)

Source

in vitro E.coli expression system

Expression Region

1-303

Target Protein Sequence

MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEIAFRPNDPKSYMTYVDNIDNFLKKYRDSAQKDDMIFEDCGNVPSELKDRGEFNNEQGERKVCRFKLEWLGNCSGINDETYGYKEGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVQCTGKRDEDKEKVGSIEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane.; Involved in cell adhesion and establishing epithelial cell polarity.

Gene References into Functions

shifts in voltage dependence and kinetics for mutant K65C show that charged lysine residue,conserved in beta1 isoforms, directly influences the effective potential that determines voltage dependence of extracellular cation binding and release PMID:15851504

Hide All

Subcellular Location

Cell membrane; Single-pass type II membrane protein. Apical cell membrane; Single-pass type II membrane protein. Cell membrane, sarcolemma.

Protein Families

X(+)/potassium ATPases subunit beta family

Database Links

UNIGENE: Oar.421

KEGG: oas:443384

Promotions