Recombinant Sheep Gonadotropin-releasing hormone receptor (GNRHR)

Code: CSB-CF009637SH
Size:
20μg
20μg100μg
US$4949
Quantity:
Express system: in vitro E.coli expression system
Species: Ovis aries (Sheep)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
GNRHR
Uniprot NO.
Alternative Names
GNRHR; Gonadotropin-releasing hormone receptor; GnRH receptor; GnRH-R
Species
Ovis aries (Sheep)
Source
in vitro E.coli expression system
Expression Region
1-328
Target Protein Sequence
MANGDSPDQNENHCSAINSSILLTPGSLPTLTLSGKIRVTVTFFLFLLSTIFNTSFLLKL QNWTQRKEKRKKLSKMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL KLFSMYAPAFMMVVISLDRSLAITRPLAVKSNSKLGQFMIGLAWLLSSIFAGPQLYIFGM IHLADDSGQTEGFSQCVTHCSFPQWWHQAFYNFFTFSCLFIIPLLIMLICNAKIIFTLTR VLHQDPHKLQLNQSKNNIPQARLRTLKMTVAFATSFTVCWTPYYVLGIWYWFDPDMVNRV SDPVNHFFFLFAFLNPCFDPLIYGYFSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. data suggest that decrease in LH secretion during the long photoperiod in sheep may be due to low translational activity of genes encoding both GnRH and GnRHR. PMID:27901351
  2. These results suggested that beta-endorphinergic system in the hypothalamus of follicular-phase ewes affects directly or via beta-endorphin-sensitive interneurons GnRH and GnRHR biosynthesis leading to suppression in secretory activity of the hypothalamic-pituitary axis. PMID:27335238
  3. These results indicate that the disturbances of gonadotropin secretion under stress conditions in sheep may be due to a dysfunction of GnRH and GnRHR biosynthetic pathways. PMID:27629353
  4. Data indicate that ESR1 on plasma membrane surface is likely candidate for mediating E2 up-regulation of GNRHR expression in pituitary cells; this signaling mechanism proceeds through CREB-dependent pathway. PMID:21734267
  5. LPS injections decrease GnRH and GnRHR genes expression in brain. PMID:20427135
  6. Short as well as prolonged stress stimuli caused an increase in GnRH-R mRNA levels in the hypothalamus and pituitary. PMID:17435833
  7. cortisol acts via the type II glucocorticoid receptor within the pituitary gland to elicit a rapid decrease in responsiveness to GnRH, independent of changes in expression of the GnRH receptor PMID:17962347
  8. Infusion of sulpiride into the third ventricle increases GnRH mRNA levels in the anterior pituitary gland. PMID:18528813

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

UNIGENE: Oar.486

KEGG: oas:443413

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products