Home
Product
Protein
Transmembrane Proteins
Recombinant Sheep Gonadotropin-releasing hormone receptor (GNRHR)

Recombinant Sheep Gonadotropin-releasing hormone receptor (GNRHR)

Code: CSB-CF009637SH

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4949

Quantity:

Express system: in vitro E.coli expression system

Species: Ovis aries (Sheep)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

GNRHR

Uniprot NO.

P32237

Alternative Names

GNRHR; Gonadotropin-releasing hormone receptor; GnRH receptor; GnRH-R

Species

Ovis aries (Sheep)

Source

in vitro E.coli expression system

Expression Region

1-328

Target Protein Sequence

MANGDSPDQNENHCSAINSSILLTPGSLPTLTLSGKIRVTVTFFLFLLSTIFNTSFLLKL QNWTQRKEKRKKLSKMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL KLFSMYAPAFMMVVISLDRSLAITRPLAVKSNSKLGQFMIGLAWLLSSIFAGPQLYIFGM IHLADDSGQTEGFSQCVTHCSFPQWWHQAFYNFFTFSCLFIIPLLIMLICNAKIIFTLTR VLHQDPHKLQLNQSKNNIPQARLRTLKMTVAFATSFTVCWTPYYVLGIWYWFDPDMVNRV SDPVNHFFFLFAFLNPCFDPLIYGYFSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system.

Gene References into Functions

data suggest that decrease in LH secretion during the long photoperiod in sheep may be due to low translational activity of genes encoding both GnRH and GnRHR. PMID:27901351
These results suggested that beta-endorphinergic system in the hypothalamus of follicular-phase ewes affects directly or via beta-endorphin-sensitive interneurons GnRH and GnRHR biosynthesis leading to suppression in secretory activity of the hypothalamic-pituitary axis. PMID:27335238
These results indicate that the disturbances of gonadotropin secretion under stress conditions in sheep may be due to a dysfunction of GnRH and GnRHR biosynthetic pathways. PMID:27629353
Data indicate that ESR1 on plasma membrane surface is likely candidate for mediating E2 up-regulation of GNRHR expression in pituitary cells; this signaling mechanism proceeds through CREB-dependent pathway. PMID:21734267
LPS injections decrease GnRH and GnRHR genes expression in brain. PMID:20427135
Short as well as prolonged stress stimuli caused an increase in GnRH-R mRNA levels in the hypothalamus and pituitary. PMID:17435833
cortisol acts via the type II glucocorticoid receptor within the pituitary gland to elicit a rapid decrease in responsiveness to GnRH, independent of changes in expression of the GnRH receptor PMID:17962347
Infusion of sulpiride into the third ventricle increases GnRH mRNA levels in the anterior pituitary gland. PMID:18528813