Home
Product
Protein
Transmembrane Proteins
Recombinant Sheep Antigen-presenting glycoprotein CD1d (CD1D)

Recombinant Sheep Antigen-presenting glycoprotein CD1d (CD1D)

Code: CSB-CF004892SH

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4874

Quantity:

Express system: in vitro E.coli expression system

Species: Ovis aries (Sheep)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

CD1D

Uniprot NO.

O62848

Species

Ovis aries (Sheep)

Source

in vitro E.coli expression system

Expression Region

18-335

Target Protein Sequence

SFEAPQTSFPFRFLQISSFANHSWTRTDGLMWLGELQPYTWRNESSTIRFLKHWSQGTFSDQQWEQLQHTFQVYRSSFTRDIREFVKMLPGDYPFEIQISGGCELLPRNISESFLRAALQEKDVLSFQGMSWVSAPDAPPWSQVVCKVLNEDQGTKETVHWLLHDICPELVKGLMQTGKSELEKQVKPEAWLSSGPSPGPDRLLLGCHVSGFYPKPVWVMWMRGEQEEPGTQQGDVMPNADSTWYLRVTLEVAAGEAAGLSCRVKHSSLGDQDIILYWDGKRVSRGLIVVLVILVFVLLFVGGLVFWFRKHRRYQDIS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells.

Subcellular Location

Cell membrane; Single-pass type I membrane protein. Basolateral cell membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein.

Tissue Specificity

Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.

Database Links

UNIGENE: Oar.1049

KEGG: oas:100144424

Promotions