Recombinant Saguinus oedipus Membrane cofactor protein (CD46)

Code: CSB-CF004939SWB
Size:
20μg
20μg100μg
US$5024
Quantity:
Express system: in vitro E.coli expression system
Species: Saguinus oedipus (Cotton-top tamarin)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
CD46
Uniprot NO.
Alternative Names
CD46; MCP; Membrane cofactor protein; CD antigen CD46
Species
Saguinus oedipus (Cotton-top tamarin)
Source
in vitro E.coli expression system
Expression Region
33-370
Target Protein Sequence
DACGPPPTFEAMELTSRPKPYYKVGERVEYDCKKGYHHFAPFLTHSICDRNHTWLPISDEPCVRKVCHYIPNPLHGEAILANGSYSFGNQLHFICNDGYYLIGKEILYCELKGSDAVWSGRPPICQKILCKPPPKINNGKHTFSDVDVFEYLDAVTYSCDPAPGPDPFSLIGESTIYCRDNSVWSGDAPECKVVKCRFPVIENGKQIAGFGKKFYYKATVIFECDEGFHIIGSDTIVCNSNSTWDPPVPKCVKVSTSPATVSPTSSVPGYPNPDEGMLNSLDEWAIALIVIAILVGVAIISFGLHRYLQRRKKKGKADGTAEYATYQSKSATLAEQRS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Acts as a cofactor for complement factor I, a serine protease which protects autologous cells against complement-mediated injury by cleaving C3b and C4b deposited on host tissue. May be involved in the fusion of the spermatozoa with the oocyte during fertilization. Also acts as a costimulatory factor for T-cells which induces the differentiation of CD4+ into T-regulatory 1 cells. T-regulatory 1 cells suppress immune responses by secreting interleukin-10, and therefore are thought to prevent autoimmunity.
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane; Single-pass type I membrane protein.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products