Home
Product
Protein
Transmembrane Proteins
Recombinant Saccharomyces cerevisiae Mitochondrial carrier protein MTM1 (MTM1)

Recombinant Saccharomyces cerevisiae Mitochondrial carrier protein MTM1 (MTM1)

Code: CSB-CF344878SVG

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5233

Quantity:

Express system: in vitro E.coli expression system

Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

MTM1

Uniprot NO.

P53320

Alternative Names

MTM1; YGR257C; G9175; Mitochondrial carrier protein MTM1; Manganese trafficking factor for mitochondrial SOD2

Species

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Source

in vitro E.coli expression system

Expression Region

1-366

Target Protein Sequence

MSDRNTSNSLTLKERMLSAGAGSVLTSLILTPMDVVRIRLQQQQMIPDCSCDGAAEVPNA VSSGSKMKTFTNVGGQNLNNAKIFWESACFQELHCKNSSLKFNGTLEAFTKIASVEGITS LWRGISLTLLMAIPANMVYFSGYEYIRDVSPIASTYPTLNPLFCGAIARVFAATSIAPLE LVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIY WSSYELCKERLWLDSTRFASKDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISM MNNSDPKGGNRSRNMFKFLETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEISKKVF GNKLHQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Involved in the mitochondrial activation of SOD2 by specifically facilitating insertion of the essential manganese cofactor. Has the ability to activate iron regulon in an iron-dependent manner. Responds to calorie restriction (CR) strength.

Gene References into Functions

The mitochondrial proteome of Deltamtm1 knockout yeast is depleted of pyridoxal 5'-phosphate. PMID:25637770
transposon insertions in two genes were able to rescue the growth defect resulting from MTM1 deletion on nonfermentable carbon source. PMID:20344951

Hide All

Subcellular Location

Mitochondrion inner membrane; Multi-pass membrane protein.

Protein Families

Mitochondrial carrier (TC 2.A.29) family

Database Links

KEGG: sce:YGR257C

STRING: 4932.YGR257C

Promotions