Vamp2; Syb2; Vesicle-associated membrane protein 2; VAMP-2; Synaptobrevin-2
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
2-116
Target Protein Sequence
SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Involved in the targeting and/or fusion of transport vesicles to their target membrane. Major SNARE protein of synaptic vesicles which mediates fusion of synaptic vesicles to release neurotransmitters. Essential for fast vesicular exocytosis and activity-dependent neurotransmitter release as well as fast endocytosis that mediates rapid reuse of synaptic vesicles. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Gene References into Functions
our findings show an intimate interaction between the dynamics of the VAMP2 transmembrane domains via the central glycine and the fluidity of the lipid membrane. In turn, this interaction influences greatly the likelihood and speed of fusion pore opening and expansion.PMID:28588281
The ternary complex of syntaxin1:SNAP25:Munc18-1binds synaptobrevin with fast kinetics, resulting in the rapid formation of a fully zippered SNARE complex to which Munc18-1 remains tethered by the N-terminal domain of syntaxin1.PMID:28483813
Syp1 clears Syb2 from the presynaptic active zone to prevent short-term depression.PMID:26854222
These effects weaken the integrity of the outer membrane layer and are attributed mainly to the highly charged linker and juxtamembrane regions of sybIIPMID:26851777
miR-206 regulates lung surfactant secretion by limiting the availability of VAMP-2 protein.PMID:25481410
distribution of SNAP25, VAMP1 and VAMP2 in adult deep cerebellar nuclei differs significantly from that found in newborn DCN and administration of E2 in the newborn DCN affected synaptic density and also changed their distributionPMID:24534378
a novel interaction between SERT and a synaptic vesicle proteinPMID:24878716
In vivo silencing of VAMP2 but not VAMP3 in TALs blunted cAMP-stimulated steady-state surface NKCC2 expression and completely blocked cAMP-stimulated NKCC2 exocytic deliveryPMID:25008321
We suggest that VAMP-2 is the v-SNARE (vesicle SNARE) involved in regulated surfactant secretion.PMID:22571236
The Ca2+-dependent transition in syntaxin 1A (Syx) involves zippering between the membrane-proximal juxtamembrane regions of Syx and VAMP2.PMID:23641074
Block of Synaptobrevin Inhibits Endocytosis Induced by boiled tetanus toxin.PMID:23643538
SNAP23-VAMP2 interaction plays a key role in cAMP-mediated exocytosis from parotid glands.PMID:23380067
Amyloid-beta acts as a regulator of neurotransmitter release disrupting the interaction between synaptophysin and VAMP2PMID:22905234
a mechanism whereby fusion pore formation is induced by movement of the charged syb2 C-terminus within the membrane in response to pulling and tilting forcePMID:23009845
VAMP2, SNAP25b and syntaxin 1 characterize most cerebellar glutamatergic synapses and only one type of GABAergic synapse.PMID:22094010
Dysregulation of SNARE complex and syt-1 in prefrontal cortex of adult-onset hypothyroidism can be restored by T(4) treatment.PMID:21646859
Munc18-1 and the neuronal SNAREs (t-SNARE (syntaxin 1.SNAP-25) and v-/t-SNARE (VAMP2.syntaxin 1.SNAP-25) complexes) already have the inherent capability to function as a basic stage-specific off/on switch to control membrane fusionPMID:21730064
Data show that most of the synaptobrevin SNARE motif has a remarkable reluctance to bind membranes.PMID:21768342
Synaptophysin and synaptobrevin 2 were expressed in a dynamic manner during the development of rat cochleaPMID:21556117
Data showv that complexin 2 interacts with vesicle-associated membrane protein (VAMP) 2, syntaxins 3 and 4.PMID:20829354
In the incisor dental pulp, all nerve fibers display immunoreactivity for syntaxin-1, synaptosomal-associated protein (SNAP)-25, and vesicle-associated membrane protein (VAMP)-2.PMID:20186959
the ability of sybII to support exocytosis is inhibited by addition of one or two residues to the sybII C terminus depending on their energy of transfer from water to the membrane interface, following a Boltzmann distributionPMID:20937897
tomosyn controls synaptic vesicle fusion positively by serving as a placeholder for VAMP2.PMID:20633536
Recombinant VAMP2 could serve as a replacement for VAMP2 synthetic peptide, potentially useful in endopeptidase assays for replacement of the currently used mouse bioassay for clostridial neurotoxins contaminating biotherapeutic products.PMID:20005125
synaptobrevin 2 forms complexes with the plasma membrane-bound SNAREs syntaxin 1A and SNAP25 to initiate the fusion reaction.PMID:12177041
Data suggest that synaptophysin I has multiple roles in neurotransmitter release, regulating VAMP2 availability for the soluble N-ethylmaleimide-sensitive factor attachment protein receptor complex and participating in the late steps of exocytosis.PMID:12181340
VAMP2 mRNA is increased during nerve regeneration of the facial motor nucleus after axotomy.PMID:12191731
Dimerization of synaptobrevin 2 in membranes is very weak, questioning any possible functional role for this association in vivo.PMID:12501216
vesicle-associated membrane protein 2 is involved in secretion of polypeptides from the choroid plexus epithelium.PMID:12559091
cytoplasmic domain of VAMP2 was found to be necessary for both the formation of VAMP2-SypI hetero-dimers and for VAMP2 sorting to SVsPMID:14528015
Synaptobrevin-2 is present in approximately 35% of the taste cells in rat circumvallate taste buds and colocalizes with SNAP-25, serotonin, protein gene product 9.5. and type III inositol 1,4,5-triphosphate receptor.PMID:14983476
Homodimerization of Vamp2 is mediated by its transmembrane segment.PMID:15109254
Data suggest that VAMP2-dependent exocytosis regulates plasma membrane insertion of TRPC3 channels and contributes to carbachol-stimulation of Ca2+ influx.PMID:15327778
cAMP increases NKCC2 surface expression by a mechanism involving VAMP and that NKCC2 trafficking to the apical membrane is involved in the stimulation of Tkidney medulla NaCl absorption by cAMP.PMID:16144963
VAMP 2 is the most abundant isoform in the rat brain and is widely distributedPMID:16169186
in astrocytes, a subpopulation of vesicles (tagged with a synaptobrevin2-EGFP chimera) is highly mobile and can fuse with the plasma membrane, at the level of the astrocyte processes, in a Ca2+-dependent mannerPMID:16322057
results show SNARE nucleation restricted to N-terminal portion; zippering proceeds in an N- to C-terminal direction; synaptobrevin binds rapidly to syntaxin/SNAP-25 acceptor; stabilizing syntaxin/SNAP-25 acceptor by a peptide allowed fast liposome fusionPMID:16888141
Individual pancreatic acinar cells express VAMP 2-specific populations of zymogen granules that orchestrate the constitutive and calcium(2+)-regulated secretory pathways.PMID:17272274
VAMP2 is expressed in muscle satellite cells and up-regulated during muscle regeneration.PMID:17468895
Cleavage of synaptobrevin 2 by tetanus toxin, known to reduce neurotransmission, did not affect the respiratory response to K+, whereas the general excitability of d PC12 cells increasedPMID:18086678
analysis of SNARE mutations that cause a decrease in the ability of botulinum toxin-resistant synaptobrevin 2 to rescue regulated exocytosis in toxin-treated neuroendocrine cellsPMID:18508917
analysis of the substrate recognition mechanism of VAMP/synaptobrevin-cleaving clostridial neurotoxinsPMID:18511418
VAMP2 may contribute to the activity dependence of dense-core vesicles releasePMID:18542995
Findings suggest the involvement of VAMP2 in the development of skeletal muscles of somitic and non-somitic origins.PMID:18570252
Results show that synaptophysin-containing cells co-expressed vesicular-associated membrane protein 2 and cholecystokinin.PMID:19253017
30 mW/cm(2) (SAR 14.1 W/kg) microwave radiation can result in the perturbation of the synaptic vesicles associated proteins: synapsin I, synaptophysin, VAMP-2, and syntaxin.PMID:19603498
VAMP2, VAMP5, and VAMP7 may be involved in translocation of GLUT4 during muscle contractions.PMID:19675279
Data suggest that VAMP2 modulates Kv2.1 inactivation by interfering with the interaction between the docking loop and C1a, a mechanism for gating regulation that may pertain also to other Kv channels.PMID:19690160
Under appropriate conditions a docked state, mediated by trans-SNARE interactions, can be isolated that constitutes an intermediate in the fusion pathway.PMID:19843696
Show
More
Hide
All
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell membrane.
Protein Families
Synaptobrevin family
Tissue Specificity
Nervous system specific. A higher level expression is seen in the brain as compared to the spinal cord. Expressed in hippocampal neurons.