Home
Product
Protein
Transmembrane Proteins
Recombinant Rat UDP-glucuronosyltransferase 1A1 (Ugt1a1)

Recombinant Rat UDP-glucuronosyltransferase 1A1 (Ugt1a1)

Code: CSB-CF717550RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6281

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Ugt1a1

Uniprot NO.

Q64550

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

30-535

Target Protein Sequence

GKLLVIPIDGSHWLSMLGVIQQLQQKGHEVVVIAPEASIHIKEGSFYTMRKYPVPFQNEN VTAAFVELGRSVFDQDPFLLRVVKTYNKVKRDSSMLLSGCSHLLHNAEFMASLEQSHFDA LLTDPFLPCGSIVAQYLSLPAVYFLNALPCSLDLEATQCPAPLSYVPKSLSSNTDRMNFL QRVKNMIIALTENFLCRVVYSPYGSLATEILQKEVTVKDLLSPASIWLMRNDFVKDYPRP IMPNMVFIGGINCLQKKALSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALG RIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKARAFITHSGSHGIYEGICNGVP MVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLH KDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVY KSCAYGCRKCFGGKGRVKKSHKSKTH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol, estrone and estriol. Involved in the glucuronidation of bilirubin, a degradation product occurring in the normal catabolic pathway that breaks down heme in vertebrates. Also catalyzes the glucuronidation the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties. Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, a drug which can inhibit the effect of angiotensin II. Involved in the biotransformation of 7-ethyl-10-hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan.

Gene References into Functions

study indicated that Status Epilepticus altered the expression of brain Ugt1a1 and Ugt1a7, which could alter glucuronidation in the brain. PMID:29131354
UGT1A1 controls estrogen metabolism. PMID:28479355
Data indicate that the up-regulation of phase II detoxification in the DR group was confirmed by mRNA and protein expression levels of uridinediphospho-glucuronosyltransferase and glycine-N-acyltransferase in actual liver tissues. PMID:23230277
Both fipronil and fipronil sulfone treatments induced a 2.5-fold increase in Ugt1a1 and Sult1b1 messenger RNA (mRNA) expressions. PMID:22447239
UDP-glucuronosyltransferase (UDP-GT) activities towards p-nitrophenol were markedly increased in rats that consumed tea.Induction of UDP-glucuronosyltransferase activity by tea may involve the UDP-GT1 (UGT1A) gene complex of the UDP-GT multigene family PMID:11983278
These results indicate that the expression of extrahepatic UDP-glucuronosyltransferases UGT1a1 and UGT1a6 is isoform-specific and regulated differentially in tissues by the pituitary gland. PMID:12153725
Our findings show that the absence of UGT1 protein from Gunn rat hepatocytes is due to rapid degradation of the truncated UGT1 protein by the proteasome and elucidate the molecular basis underlying the deficiency in bilirubin glucuronidation. PMID:12220528
Developmental stage-specific switching of regulation of the rat UGT1 gene complex was found. PMID:18938141
Data suggest that thyroid hormones and vitamin A are co-regulators of UDP-glucuronosyltransferase (UGT) 1 expression, without affecting the UGT2 family PMID:11997190