Home
Product
Protein
Transmembrane Proteins
Recombinant Rat Tumor necrosis factor receptor superfamily member 4 (Tnfrsf4)

Recombinant Rat Tumor necrosis factor receptor superfamily member 4 (Tnfrsf4)

Code: CSB-CF023981RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4380

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Tnfrsf4

Uniprot NO.

P15725

Alternative Names

Tnfrsf4; Ox40; Txgp1l; Tumor necrosis factor receptor superfamily member 4; MRC OX40; OX40 antigen; OX40L receptor; CD antigen CD134

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

20-271

Target Protein Sequence

VTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCHPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGVDCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLVAPEGPAFAVILGLGLGLLAPLTVLLALYLLRKAWRSPNTPKPCWGNSFRTPIQEEQTDTHFTLAKI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.

Gene References into Functions

OX40 and OX40L may play a role in the pathogenesis of experimental allegic neuritis. PMID:20871162
Ox40-Ox40 ligand is a critical pathway in alloimmune responses, especially recall/primed responses, and is synergistic with CD28-B7 in mediating T cell effector responses during allograft rejection. PMID:12626546

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein.

Tissue Specificity

Activated T-cells.

Database Links

UNIGENE: Rn.48883

KEGG: rno:25572

STRING: 10116.ENSRNOP00000027251

Promotions