MQQPVNYPCPQIYWVDSSATSPWAPPGSVFSCPSSGPRGPGQRRPPPPPPPPSPLPPPSQPPPLPPLSPLKKKDNIELWLPVIFFMVLVALVGMGLGMYQLFHLQKELAELREFTNHSLRVSSFEKQIANPSTPSETKKPRSVAHLTGNPRSRSIPLEWEDTYGTALISGVKYKKGGLVINEAGLYFVYSKVYFRGQSCNSQPLSHKVYMRNFKYPGDLVLMEEKKLNYCTTGQIWAHSSYLGAVFNLTVADHLYVNISQLSLINFEESKTFFGLYKL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. Involved in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development. Initiates fratricidal/suicidal activation-induced cell death (AICD) in antigen-activated T-cells contributing to the termination of immune responses. TNFRSF6/FAS-mediated apoptosis has also a role in the induction of peripheral tolerance. Binds to TNFRSF6B/DcR3, a decoy receptor that blocks apoptosis.; Induces FAS-mediated activation of NF-kappa-B, initiating non-apoptotic signaling pathways. Can induce apoptosis but does not appear to be essential for this process.; Cytoplasmic form induces gene transcription inhibition.
The expression of apoptosis-related genes Fas and FasL in rats with an experimentally induced left-side varicocele was significantly increased compared to that in the control group.PMID:28722192
Hepatitis B virus X protein modulates apoptosis in tubule renal cells and activates Fas/FasL through the MLK3-MKK7-JNK3 signaling pathway.PMID:27606894
PEDF inhibits angiogenesis in the heart by inducing tip cells apoptosis via up-regulating PPARG to increase surface FasL.PMID:26519036
These results indicate that chorionic gonadotropin promotes follicular development via downregulation of death-inducer Fas/FasL expression and promotion of ovarian cell proliferation.PMID:25294749
Sulforafan inhibited galactosamine/lipopolysaccharide induced caspase-3 activation and suppressed FAS and FASL expression.PMID:25439027
CCN1, often co-expressed with FasL in a stressed heart, sensitizes cardiomyoblasts to FasL-induced apoptosis.PMID:24631528
pTREFasLcHS4V16 with an improved tet-on system can precisely regulate the expression of FasL gene and apoptosis for arthritis treatment.PMID:21792649
Results of the study indicate a time-dependent increase in the mRNA levels of Fas Ligand (FasL) and phosphatase and tensin homologue deleted on chromosome 10 (PTEN)up until 6 h after death.PMID:24297385
This study showed increase in the C-fibre response and an upregulation of the gene expression of Fasl 180 minutes after application of NP onto the nerve rootsPMID:23711477
Cerebral ischemia/reperfusion mediates procaspase-3 denitrosylation and activation through GluR6-FasL-Trx2 pathway, which leads to neuronal apoptosis and cell death.PMID:23949220
The Fas/Fas ligand death receptor pathway contributes to phenylalanine-induced apoptosis.PMID:23940767
Prolonged mechanical ventilation induces apoptosis of alveolar type II cells in newborn rats via the extrinsic death pathway and the FasL/Fas system.PMID:23934924
Overexpression of SIRT1 up-regulates FasL expression in both flow-restricted mouse carotid arteries and serum-stimulated vascular smooth muscle cell.PMID:23806367
Hypoxia causes the upregulation of FasL expression but the downregulation of miR-21 expression in microglia.PMID:22907769
Soluble FasL is locally produced in the chronically inflamed testis.PMID:22892327
FasL governs the immunoregulatory property of dental pulp stem cells in the context of inducing T-cell apoptosis.PMID:22904205
In summary, the Fas/FasL pathway involved in alveolar epithelial cell apoptosis could be important in the pathogenesis of seawater-induced acute lung injuryPMID:22609371
Carbon disulfide causes apoptosis of sertoli cells and increases expression of FasL.PMID:17241545
Data suggest the potential therapeutic applications for suppression of rheumatoid arthritis (RA) by local joint delivery of CTLA4-FasL.PMID:22354915
Endothelial cells with expression of FasL or viruses recombinant with FasL gene transfusion can preserve liver function and prolong the survival time of liver allografts.PMID:22664023
observations indicate that CTLA4-FasL protein represents a significantly suppressive effect on inflammatory fibroblast-like synoviocytes' proliferationPMID:22325471
Fluorofenidone significantly reduced Ang II-induced increases in Fas, FasL at the mRNA level.PMID:21586345
analysis of of functionally active Fas ligand interfering protein (FIP)PMID:18204739
Apoptosis mediated by Fas/FasL may play an important role in the pathogenesis of acute liver injury.PMID:16831245
overexpression of miR-21 protects against ischemic neuronal death, and that downregulation of FASLG, an important cell death-inducing ligand whose gene is targeted by miR-21, probably mediates the neuroprotective effectPMID:20840605
The reverse transcriptase polymerase chain reaction demonstrated Fas gene expression in liver and renal tissues at 1 hour after liver transplantation.PMID:20620473
Se deficiency can lead to over expression of Fas/FasL.PMID:19239001
p,p'-DDE could induce DNA damage and FasL gene expression of Sertoli cells of rat testis.PMID:16921742
down-regulating FasL expression and/or function in glial malignancies can enhance T-cell tumor infiltration and inhibit tumor growthPMID:20406899
Resveratrol treatment significantly increased the apoptotic indices of pancreatic acinar cells and the levels of FasL mRNA and protein in rats with severe acute pancreatitis.PMID:19304523
Fas/FasL system may function as a possible mechanism mediating estrogen-induced apoptosis in the thymus. The present data demonstrate...Fas/FasL system could play an important role maintaining this balance as the mediators of programmed cell death.PMID:11642679
Corticotropin-releasing hormone induces Fas ligand production and apoptosis in PC12 cells via activation of p38 mitogen-activated protein kinasePMID:11790788
Notch3 signaling in vascular smooth muscle cells induces c-FLIP expression via ERK/MAPK activation. Resistance to Fas ligand-induced apoptosisPMID:11925448
Mitochondrial oxidative stress and CD95 ligand: a dual mechanism for hepatocyte apoptosis in chronic alcoholism.PMID:11981771
Oxidative stress is a major stimulus in eliciting Fas and FasL expression in NGF-differentiated PC12 cells. Moreover, we describe here for the first time the existence of cAMP-dependent mechanism(s) modulating Fas and FasL expression.PMID:12111799
findings support the hypothesis that the expression of FasL in normal ovary is hormonally sensitivePMID:12113885
Hyperosmotic hepatocyte shrinkage induces CD95 trafficking to the plasma membrane, which involves JNK-, PKA-, and PKC-dependent mechanisms and sensitizes hepatocytes toward CD95L-mediated apoptosis.PMID:12198652
The consequences of FasL overexpression depend on the subcellular compartment and species in which FasL enforced expression is targeted and this is at least partially related to FLIP levelsPMID:12477972
The results suggest that recruitment of preformed FasL from intracellular compartments, rather than its biosynthesis, is responsible for the increase in FasL on the cell surface following IFN-gamma stimulation.PMID:12904679
downregulation of Akt signalling and activation of Forkhead is a prerequisite for the induction of FasL promoterPMID:14576824
CD95 ligand-induced CD95 activation in rat hepatocytes is inhibited by CD95-tyrosine nitrationPMID:14679192
FasL expression in rat testis is present from the early postnatal days up to the adult, and the Sertoli cells is the main FasL expressing cell within the seminiferous tubule.PMID:15379972
Fas ligand is not detected in the notochord. During intervertebral disc formation, Fas ligand is expressed in the nucleus pulposus. The disc's immune privilege may begin early in disc formation. Fas ligand may play an important role in disc formation.PMID:15507796
NO inhibited Fas/FasL system-induced apoptosis by suppressing activation of the caspases, pointing to a cross-talk between Fas/FasL system-induced apoptosis pathway and NO-mediated antiapoptotic pathway in ovarian follicle atresia.PMID:15528299
FasL protein expression was localized to caveolae membrane domainsPMID:15541714
Acute pancreatitis induces liver injury and hepatocyte death while up-regulating FasL, p38-MAPK, and caspase-3. Fas is up-regulated within Kupffer cells, suggesting that FasL may autoregulate its production by inducing its originator-cell death.PMID:15555619
METH causes some of its neurodegenerative effects, in part, via stimulation of the Fas-mediated cell death pathway consequent to FasL up-regulation mediated by activation of multiple TFs.PMID:15644446
Mitochondria-derived ROS and calcium play a key role in stimulating DOX-induced 'intrinsic and extrinsic forms' of apoptosis in cardiac cells with Fas L expression via the NFAT signalling mechanism.PMID:15799720
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type II membrane protein. Cytoplasmic vesicle lumen. Lysosome lumen.; [Tumor necrosis factor ligand superfamily member 6, soluble form]: Secreted.; [FasL intracellular domain]: Nucleus.
Protein Families
Tumor necrosis factor family
Tissue Specificity
Expressed in activated splenocytes and thymocytes. Moderate or weak expression found in small intestines, kidney and lung.