Recombinant Rat Thromboxane A2 receptor (Tbxa2r)

Code: CSB-CF023260RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5046

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Tbxa2r

Uniprot NO.

P34978

Alternative Names

Tbxa2r; Thromboxane A2 receptor; TXA2-R; Prostanoid TP receptor; TXR2

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-341

Target Protein Sequence

MWLNSTSLGACFRPVNITLQERRAIASPWFAASFCALGLGSNLLALSVLAGARPGAGPRS SFLALLCGLVLTDFLGLLVTGAVVASQHAALLDWRATDPGCRLCHFMGAAMVFFGLCPLL LGAAMAAERFVGITRPFSRPAATSRRAWATVGLVWVGAGTLGLLPLLGLGRYSVQYPGSW CFLTLGAERGDVAFGLMFALLGSVSVGLSLLLNTVSVATLCRVYHAREATQRPRDCEVEM MVQLVGIMVVATVCWMPLLVFILQTLLQTLPVMSPSGQLLRTTERQLLIYLRVATWNQIL DPWVYILFRRSVLRRLHPRFTSQLQAVSLHSPPTQAMLSGP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for thromboxane A2 (TXA2), a potent stimulator of platelet aggregation. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. In the kidney, the binding of TXA2 to glomerular TP receptors causes intense vasoconstriction. Activates phospholipase C and adenylyl cyclase.

Gene References into Functions

We conclude that hyperglycemia activates thromboxane A2 receptor to impair the integrity and function of blood-brain barrier via the ROCK-PTEN-Akt-eNOS pathway. PMID:28415790
Data suggest that thromboxane A2/Tbxa2r-mediated vasoconstriction of intracavernous small penile arteries depends on Ca2+ influx through L-type calcium channels and TRP (transient receptor potential) channels, and ROCK- (Rho kinase)-dependent mechanisms in vascular smooth muscle. PMID:26708952
The experiments suggest that in the SHR but not the WKY aorta, alpha1 -adrenoceptor activation desensitizes TP receptors through activation of PKC-epsilon. PMID:25857252
Low-dose TP stimulation constricts the ductus arteriosus with minimal adverse effects at least in rat neonates. PMID:22717688
analysis of hypersensitivity to the thromboxane receptor mediated cerebral vasomotion and CBF oscillations during acute NO-deficiency in rats PMID:21217826
vasoconstrictor TP receptor and MaxiK-channel direct interaction facilitates G-protein-independent TP to MaxiK trans-inhibition, which would promote vasoconstriction. PMID:20959415
Here we examined a role of PPAR-gamma in TXR gene expression in VSMCs PMID:11777901
These results suggest that the impaired functional vasodilation in diabetic rats is due to hyperglycemia-mediated increases in TP-mediated vasoconstriction. PMID:16905600
post-transcriptional mechanisms are responsible for the up-regulation of TP receptor by lipid soluble smoke particles, in which enhanced translation is the major cause of the elevated protein expression and the enhanced contraction. PMID:17706224
These studies demonstrated that thromboxane A(2) receptorss couple to both G(q) and G(13) in the extranuclear compartment but only to G(s) in the nuclear compartment. PMID:18710937
Transcriptional down-regulation of thromboxane A(2) receptor expression via activation of MAPK ERK1/2, p38/NF-kappaB pathways. PMID:18769070

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

In the brain, expressed in all types of glial cells. In the kidney, expressed in the mesangial cells of the glomerulus, smooth muscle cells of the renal arterioles, and in transitional cell epithelium of renal pelvis.

Database Links

UNIGENE: Rn.44614

KEGG: rno:24816

STRING: 10116.ENSRNOP00000027932

Promotions