Home
Product
Protein
Transmembrane Proteins
Recombinant Rat T-cell surface glycoprotein CD5 (Cd5)

Recombinant Rat T-cell surface glycoprotein CD5 (Cd5)

Code: CSB-CF004942RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5996

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Cd5

Uniprot NO.

P51882

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

24-491

Target Protein Sequence

QSGRGFVGAQVMLSGSNSKCQGLVEVQMNGMKTVCSSSWRLSQDLWKNANEASTVCQQLGCGNPLALGHLTLWNRPKNQILCQGPPWSFSNCSTSSLGQCLPLSLVCLEPQKTTPLPTTTLPTTMPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSRGGTILYKAKARPVDLGNLICKSLQCGSFLTHLSRIETAGTPAPAELRDPRPLPIRWEAQNGSCTSLQQCFQKTTVQEGSQALAVVCSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWAALCDSSAARGPGRWEELCQEQQCGNLISFHVMDADRTSPGVLCTQEKLSQCYQLQKKTHCKRVFITCKDPNPVGLAPGTVASIILTLVLLVVLMVMCGPLIYKKLVKKFRQKKQRQWIGPTGVNQSMSFHRSHTATVRSQVENPAASHVDNEYSQPPRNSRLSAYPALEGALHRSSTQPDNSSDSDYDLQVAQRL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

May act as a receptor in regulating T-cell proliferation.

Gene References into Functions

The fact that both the extracellular and the cytoplasmic domains of CD2 interact with CD5 suggests a specific and tight association between the two molecules, possibly relevant for the fine-tuning of signal transduction in T lymphocytes. PMID:11981840

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Database Links

UNIGENE: Rn.11337

KEGG: rno:54236

STRING: 10116.ENSRNOP00000051697

Promotions