Cd28; T-cell-specific surface glycoprotein CD28; CD antigen CD28
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
20-218
Target Protein Sequence
NKILVKQSPLLVVDNNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRPNVGFNCDGNFDNETVTFRLWNLDVNHTDIYFCKIEVMYPPPYLDNEKSNGTIIHIKEKHLCHAQTSPKLFWPLVVVAGVLLCYGLLVTVTLCIIWTNSRRNRLLQSDYMNMTPRRLGPTRKHYQPYAPARDFAAYRP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation.
Gene References into Functions
this study identified two crucial immune-related molecules-CD28 and NFATc1, as putative targets of miR-145 in human and experimental myasthenia gravisPMID:24043548
CD28 superagonist antibody treatment attenuated obliterative bronchiolitis in rat allo-orthotopic tracheal transplantation by preferentially expanding Foxp3-expressing regulatory T cells.PMID:22564625
Data demonstrate that the superagonistic monoclonal antibody for CD28, JJ316, preferentially expanded Treg cells.PMID:21487638
Data show several homologies across human, rat and mouse in the kinetic of loss of several LAgs such as CD5, CD4 and CD28.PMID:21745657
Tongbi Mixture 2 can inhibit T lymphocytes through down-regulating the expressions of CD28 and CD152.PMID:18601859
the Th2-response in mercuric chloride-induced autoimmunity requires continuing costimulation via CD28PMID:12197880
Data show that superagonists bind to the laterally exposed C"D loop of the immunoglobulin-like domain of CD28 but conventional, costimulatory monoclonal antibodies recognize an epitope close to the binding site for the natural CD80/CD86 ligands.PMID:12707299
translocation to lipid rafts may play an important role in CD28 signaling.PMID:15280538
Mechanism for lack of Cbl-b down-regulation may involve the proteasome since blocking proteasomal activity in young T-lymphocytes prevented Cbl-b down regulation while there was no effect in aged T-lymphocytes on Cbl-b expression.PMID:15491677
CD28 negative T suppressor cells protect allogenic recipients from acute rejection in rats liver transplantation.PMID:18089392
CD28 superagonists elicit 2 qualitatively distinct waves of activationPMID:18357346
Targeting the CD28 antigen with a blocking antibody leads to long-term allograft survival by reducing activation of alloantigen-mediated key signaling events in T cells that might be crucial for full T cell activation.PMID:18408588
CD28 antibody induces donor-specific tolerance in rat renal allograftsPMID:18727698
CD2/CD28 costimulation is the strongest T cell stimulus in vivo in rat lamina propria.PMID:19811406