Recombinant Rat Syntaxin-2 (Stx2)

Code: CSB-CF022898RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4664

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Stx2

Uniprot NO.

P50279

Alternative Names

Stx2; Epim; Syntaxin-2; Epimorphin

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-290

Target Protein Sequence

MRDRLPDLTACRKSDDGDNAVIITVEKDHFMDAFFHQVEEIRSSIARIAQHVEDVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANRIRGKLKAIEQSCDQDENGNRTSVDLRIRRTQHSVLSRKFVDVMTEYNEAQILFRERSKGRIQRQLEITGRTTTDEELEEMLESGKPSIFISDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMVNNIERNVVNSVDYVEHAKEETKKAIKYQSKARRKKWIIAAVVVAVIAVLALIIGLTVGK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Essential for epithelial morphogenesis. May mediate Ca(2+)-regulation of exocytosis acrosomal reaction in sperm.

Gene References into Functions

miR-124a aggravates lipopolysaccharide-induced cardiac dysfunction and the miR-124a/STX2 pathway might serve as the potential diagnostic and therapeutic targets for septic cardiac dysfunction. PMID:28560580
These data provide evidence for EPIM and SOX9 functioning by mutual negative feedback to regulate attributes of the quiescent or activated state of HSCs. PMID:24971829
Epimorphin has morphogenetic effects on several epithelial tissues, including those of lung. PMID:25119302
Epimorphin regulates bile duct formation of WB-F344 cells through effects on RhoA and C/EBPbeta, implicating a dual aspect of this morphoregulator in bile duct epithelial morphogenesis. PMID:21935930
Epimorphin regulates bile duct formation via effects on mitosis orientation PMID:20305811
expression in intestinal myofibroblasts induces epithelial morphogenesis PMID:12464668
pIgA-R traffics through postendosomal rab3D-, rab11a-, and syntaxin 2-associated compartments, implicating these proteins in the regulation of transcytosis. PMID:14578858
In conclusion, epimorphin is a factor that induces differentiation of hepatic stem-like cells through epithelial-mesenchymal cell contact. PMID:14592430
anti-oxidative function of epimorphin is dramatic and is likely mediated by the activation of EGF receptors and the MEK/extracellular signal-regulated kinase and PI3 kinase/Akt signaling pathways PMID:16891298
Epimorphin elicits hepatocyte spheroids by inducing proteases in rodent hepatocytes through NF-kappaB. PMID:17935821