Recombinant Rat Synaptophysin (Syp)-VLPs

Code: CSB-MP023024RA
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
Pls inquire
Quantity:
Express system: Mammalian cell
Species: Rattus norvegicus (Rat)
Tag Info: C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it's possible to develop.
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Syp
Uniprot NO.
Research Area
Others
Species
Rattus norvegicus (Rat)
Source
Mammalian cell
Expression Region
1-307aa
Target Protein Sequence
MDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGGGYGPQGDYGQQGYGQQGAPTSFSNQM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it's possible to develop.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity.
Gene References into Functions
  1. The environmental enrichment protected against the effects of maternal separation as indicated by the lower anxiety levels and the reversal of spatial memory deficits compared to animals housed in standard conditions. These changes were associated with increased synaptophysin expression in the hippocampus. PMID:29545098
  2. Dexamethasone treatment significantly affects both GAP-43 and synaptophysin protein expression in the hippocampus of aged rats. PMID:28801169
  3. Synaptophysin cerebellar cortex expression was significantly reduced in newborn animals from diabetic mothers. PMID:27389246
  4. showed a significant down-regulation in mRNA expression of synaptophysin in the offspring born to diabetic animals PMID:26794272
  5. Synaptophysin spinal cord levels were higher in balance and coordination trained animals compared with non-trained following sciatic nerve crush. PMID:26316168
  6. the Nociceptin/orphanin FQ receptor system influences the expression of synaptophysin PMID:25697061
  7. Results identified interesting differences between thienorphine and morphine in their effects on synaptic structure and synaptophysin expression in the rat NAc. PMID:24861887
  8. Synaptophysin content was high in all the layers of the cortex, but the most intense reaction was detected in the molecular layer, similarly with the intensity of GFAP reaction PMID:25282817
  9. data suggest that diabetes increases mRNA translation of synaptophysin in the retina, resulting in an accumulation of mannose rich glycosylated synaptophysin, a transient post-translational state of the protein PMID:22970294
  10. Phosphorylation and nitration of tyrosine residues affect functional properties of Synaptophysin and Dynamin I. PMID:23103755
  11. The expression of synaptophysin (SYP) and regenerationassociated protein (GAP43) in the injured brain of neural stem cells-transplanted rats was significantly increased. PMID:21687946
  12. The developmental changes of GluR2 and SYP expression in the rat inferior colliculus may be involved in the development and plasticity of the auditory center. PMID:20422983
  13. GAP-43 and P38 may be the pathological basis of insular epilepsy and the key molecular mechanism of synaptic plasticity. PMID:20646586
  14. Our findings implicate decreases in the number of surviving cells and alterations in the levels of caveolin-1 and synaptophysin in the impairments in neural development induced by developmental iodine deficiency and hypothyroidism. PMID:20025630
  15. stress during pregnancy reduced the expression of synaptophysin; this decrease provides evidence that synaptic integral membrane proteins are involved in altered synaptic plasticity in the adult CNS following stress exposure PMID:20035832
  16. The expression level of synaptophysin showed dynamic changes following diffuse brain injury as well as during the repair period. PMID:17330749
  17. Data suggest that synaptophysin I has multiple roles in neurotransmitter release, regulating VAMP2 availability for the soluble N-ethylmaleimide-sensitive factor attachment protein receptor complex and participating in the late steps of exocytosis PMID:12181340
  18. Synaptophysin mRNA increased in the barrel cortex contralateral to whisker stimulation, suggesting that synaptophysin is involved in the modulation of synaptic plasticity. PMID:12363201
  19. We found a kindling-induced increase in synaptophysin in various hippocampal regions and in pyriform cortex, suggesting that activation-induced sprouting extends well beyond the hippocampal mossy fiber system. cortex PMID:12453493
  20. Synaptophysin and gamma-adaptin occurred in the perinuclear region of hippocampal neurons, suggesting that synaptophysin serves as a docking site for AP-1 during clathrin-dependent vesicle budding and/or kinesin-based transport reactions. PMID:12498786
  21. synaptophysin targeting to a ubiquitous synaptic vesicle-sized compartment is facilitated by cellugyrin and synaptogyrin PMID:12928441
  22. Synaptophysin expression was assessed in dentate gyrus prepared from aged (22 months) and young (4 months) rats; marked reduction in synaptophysin expression in synaptosomes of aged compared with young rats was noted PMID:12965244
  23. Restraint stress decreased SYP in rat hippocampus by 50% and increased microtubule-associated protein 1(MAP1) by 60%. SYP returned to pre-stress levels in three weeks and MAP1 in two weeks. PMID:15584914
  24. Cognitive impairment and the expression patterns of MAP-2, GAP-43, and synaptophysin were examined in rats with permanent occlusion of bilateral common carotid arteries. PMID:15964096
  25. The dose-response effects of Aroclor 1254 on the expression of alpha-synuclein, synaptophysin and parkin in rat brains is reported. PMID:16174552
  26. Following clozapine treatment, synaptophysin expression increases in the very cortical regions in which GLT-1 expression is down-regulated. PMID:16987241
  27. The mRNA expression level of synaptophysin induced by neuronal activity is related to the regulation of synapse formation or remodeling or both. PMID:16990974
  28. Synaptophysin expression, which appeared diffusely across the cortex, increased on day 1, 3, and 5 of complex motor skill learning. PMID:17141532
  29. AMPH administered in the AMPH-paired context increased the density of both Fos and synaptophysin immunoreactivity in the dentate gyrus, cornu ammonis (CA)1, CA3, basolateral amygdala and dorsolateral striatum. PMID:17970739
  30. reduced synaptophysin protein levels in schizophrenia postmortem brains do not result from perinatal oxygen deprivation PMID:18626794
  31. Synaptophysin gene is embedded in open chromatin in R28 retinal precursor cells. PMID:18692536
  32. We found abnormal expression of the synaptic proteins synaptophysin, microtubule-associated protein 2 (MAP2) and cyclin-dependent kinase 5 (CDK5) and of the neurotrophin-3. PMID:18703118
  33. Results show that nerve growth factor regulates the intracellular distribution of the synaptic vesicle protein synaptophysin in newborn rat trigeminal ganglion neurons in vitro. PMID:19019428

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome.
Protein Families
Synaptophysin/synaptobrevin family
Tissue Specificity
Expressed in the brain with expression in the cerebrum and the cerebellum.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products