Recombinant Rat Succinate receptor 1 (Sucnr1)

Code: CSB-CF022921RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4866

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Sucnr1

Uniprot NO.

Q6IYF9

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-317

Target Protein Sequence

MAQNLSCENWLALENILKKYYLSAFYGIEFIVGMLGNFTVVFGYLFCMKNWNSSNVYLFN LSISDLAFLCTLPMLIRSYATGNWTYGDVLCISNRYVLHANLYTSILFLTFISIDRYLLM KFPFREHILQKKEFAILISLAVWVLVTLEVLPMLTFITSTPIEKGDSCVDYASSGNPKYS LIYSLCLTLLGFLIPLSVMCFFYYKMVVFLKKRSQQQATVLSLNKPLRLVVLAVVIFSVL FTPYHIMRNVRIASRLDSWPQGCSQKAIKCLYILTRPLAFLNSAVNPIFYFLVGDHFRDM LFSKLRQYFKSLTSFRL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for succinate.

Gene References into Functions

Succinate accumulation impairs cardiac pyruvate dehydrogenase activity through GRP91-dependent and independent signaling pathways: Therapeutic effects of ginsenoside Rb1. PMID:28736181
Brain cortex-specific immediate expression of GPR91 during hypoxia was related to activity of the GABA-bypass that acts as the source of succinate for the receptor under these conditions. PMID:27165084
The findings indicate that succinate-GPR91 signaling may be involved in right ventricular hypertrophy via PI3K/Akt signaling in vivo and in vitro. PMID:26824665
Results suggest that succinate-GPR91 is involved in right ventricular hypertrophy via PI3K/Akt signaling in vivo and in vitro. PMID:25337184
Uncover a dominant metabolic sensor responsible for post-HI neurovascular adaptation, notably succinate/GPR91, acting via prostaglandin E2-prostaglandin E receptor 4 to govern expression of major angiogenic factors. PMID:24285580
a pathway of metabolite signaling where succinate, acting through GPR91, governs retinal angiogenesis and show the propensity of RGCs to act as sensors of ischemic stress. PMID:18836459