Home
Product
Protein
Transmembrane Proteins
Recombinant Rat Sphingosine 1-phosphate receptor 5 (S1pr5)

Recombinant Rat Sphingosine 1-phosphate receptor 5 (S1pr5)

Code: CSB-CF864355RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5488

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

S1pr5

Uniprot NO.

Q9JKM5

Alternative Names

S1pr5; Edg8; Nrg1; Sphingosine 1-phosphate receptor 5; S1P receptor 5; S1P5; Endothelial differentiation G-protein-coupled receptor 8; Nerve growth factor-regulated G-protein-coupled receptor 1; NRG-1; Sphingosine 1-phosphate receptor Edg-8; S1P receptor Edg-8

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-400

Target Protein Sequence

MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAAVCLAVCAFIVLENLAVLLV LGRHPRFHAPMFLLLGSLTLSDLLAGAAYATNILLSGPLTLRLSPALWFAREGGVFVALA ASVLSLLAIALERHLTMARRGPAPAASRARTLAMAVAAWGLSLLLGLLPALGWNCLGRLE ACSTVLPLYAKAYVLFCVLAFLGILAAICALYARIYCQVRANARRLRAGPGSRRATSSSR SRHTPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARACPVLLQADPFLGLAMANS LLNPIIYTFTNRDLRHALLRLLCCGRGPCNQDSSNSLQRSPSAVGPSGGGLRRCLPPTLD RSSSPSEHSCPQRDGMDTSCSTGSPGAATANRTLVPDATD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. Is coupled to both the G(i/O)alpha and G(12) subclass of heteromeric G-proteins. Displays antiproliferative effects in transfected CHO-K1 and HEK293 cells.

Gene References into Functions

The LOC290876-encoded gene product (EDG-8) has distinct roles in the nucleus during the processes of spermatocyte maturation and spermatid production in meiosis. PMID:22972346
The immune modulator FTY720 targets sphingosine 1-phosphate receptors. PMID:11967257
differences between hS1P(5) and rS1P(5) will be an important point to be considered in the development of selective receptor antagonists. PMID:12234605
Edg8 receptors are preferentially expressed in oligodendrocyte lineage cells including oligodendrocyte progenitor cells and immature oligodendrocytes in rat CNS, and may have important functions in oligodendrocytic maturation and myelination. PMID:12617946
Edg8/S1P5 activation on oligodendroglial cells modulates two distinct functional pathways mediating either process retraction or cell survival and that these effects depend on the developmental stage of the cell. PMID:15703400
SphK1 has a role in regulating degranulation and motility of rat mast cells by desensitizing S1P receptors PMID:15741218
These data demonstrate novel roles of S1P(1R,) which include regulating emigration and modulating lymphocyte activation. PMID:18294150

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Found almost exclusively in brain and skin. Ubiquitously detected in different brain regions with very prominent expression in lower brain regions such as the midbrain, pons, medulla, and spinal cord. Expressed predominantly within white matter tracts of

Database Links

UNIGENE: Rn.45601

KEGG: rno:60399

STRING: 10116.ENSRNOP00000028380

Promotions