Home
Product
Protein
Transmembrane Proteins
Recombinant Rat Sphingosine 1-phosphate receptor 1 (S1pr1)

Recombinant Rat Sphingosine 1-phosphate receptor 1 (S1pr1)

Code: CSB-CF020650RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5360

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

S1pr1

Uniprot NO.

P48303

Alternative Names

S1pr1; Edg1; Sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P1; Endothelial differentiation G-protein coupled receptor 1; Sphingosine 1-phosphate receptor Edg-1; S1P receptor Edg-1; CD antigen CD363

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-383

Target Protein Sequence

MVSSTSIPVVKALRSQVSDYGNYDIIVRHYNYTGKLNIGVEKDHGIKLTSVVFILICCLI ILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFL REGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLLISACWVISLILGGLPI MGWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRK NISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVL AVLNSGTNPIIYTLTNKEMRRAFIRIISCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSS HPQKDDGDNPETIMSSGNVNSSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1. Required for normal chemotaxis toward sphingosine 1-phosphate. Required for normal embryonic heart development and normal cardiac morphogenesis. Plays an important role in the regulation of sprouting angiogenesis and vascular maturation. Inhibits sprouting angiogenesis to prevent excessive sprouting during blood vessel development. Required for normal egress of mature T-cells from the thymus into the blood stream and into peripheral lymphoid organs. Plays a role in the migration of osteoclast precursor cells, the regulation of bone mineralization and bone homeostasis. Plays a role in responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine by pulmonary endothelial cells and in the protection against ventilator-induced lung injury.

Gene References into Functions

There is a marked up-regulation of S1PR1 in hippocampus following traumatic brain injury. PMID:28018679
maternal lead in the blood affects levels of sphingosine-1-phosphate (S1P) and expression of S1P receptor 1 in the brain of the rat in the perinatal period PMID:27697711
S1P regulates cell proliferation and angiogenesis via different receptors. PMID:26543024
The neuronal sphingosine-1-phosphate/S1PR1/STAT3 signalling axis plays a critical role in the control of energy homeostasis. PMID:25255053
findings identify for the first time the S1P/S1PR1 axis as a promising molecular and therapeutic target in chemotherapy-induced painful peripheral neuropathy, establish a mechanistic insight into the biomolecular signaling pathways PMID:24876379
We demonstrate that restoration of cardiac plasma membrane levels of S1PR1 produces beneficial effects that counterbalance the deleterious beta1AR overstimulation in heart failure. PMID:23969695
Data indicate that inhibition of S1PR1 or S1PR3 decreased the velocity of S1P-induced VSMC migration by almost 75%. PMID:22828274
The S1PR1 receptors in sensory ganglia cells play an important role in regulating behavioral sensitivity during inflammation. PMID:22445889
The results obtained from the single defined neurons show that S1PR(1) plays a prominent but not exclusive role in the enhancement of neuronal excitability. PMID:22805346
analysis of quinolinone-based agonists of S1P PMID:22104144
The sphingosine-1-phosphate (S1P)-to-S1PR-1 pathway is implicated as a downstream signaling pathway in ceramide-induced hyperalgesia. PMID:21605625
Purification and identification of activating enzymes of CS-0777, a selective sphingosine 1-phosphate receptor 1 modulator, in erythrocytes. PMID:21613209
FTY720 (Gilenya) phosphate selectivity of sphingosine 1-phosphate receptor subtype 1 (S1P1) G protein-coupled receptor requires motifs in intracellular loop 1 and transmembrane domain 2 PMID:21719706
Sphingosine 1-phosphate 1 receptor (S1P1R) agonists regulate podocyte-specific proteins PMID:21289599
These results indicate that S1PR(1) plays a prominent, although not exclusive, role in mediating the enhancement of excitability of sensory neurons. PMID:20844107
The activation of endothelial S1P(R1) is responsible for the protective action of sphingosine-1-phosphate on microvessel permeability. PMID:20729401
PKC inhibition therefore may contribute to lymphopenia by down-regulating S1P(1) receptor cell surface expression independently from its activation. PMID:20032465
This lipid mediator in neural stem/progenitor cell migration may have therapeutic potential in spinal cord injury. PMID:16990586
These results indicate that CNS S1P receptors are part of a physiologically relevant and widespread neuromodulatory system, and that the S1P(1) receptor contributes to S1P-mediated antinociception. PMID:19493165