MNGTEGPNFYVPFSNITGVVRSPFEQPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG GEIGLWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP EGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVIFFLICWLPYASVAMYIFTHQGSNFGPIFMTLPAFFAKTASI YNPIIYIMMNKQFRNCMLTSLCCGKNPLGDDEASATASKTETSQVAPA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling.
Gene References into Functions
these results suggest that retinoid metabolism in the eye is impaired in type 1 diabetes, which leads to deficient generation of visual pigments and neural retinal dysfunction in early diabetes.PMID:28734946
EGF induces Ca(2+) sensitization in vascular smooth muscle by Rho-kinase-dependent inactivation of MLCP mediated by the EGF receptor/MEK/Erk1/2 pathwayPMID:26004531
Allele-specific ASO-mediated knockdown of mutant P23H rhodopsin expression slowed the rate of photoreceptor degeneration and preserved the function of photoreceptor cells in eyes of the P23H rhodopsin transgenic rat.PMID:26436889
Phosphorylation of the Rho/ROCK signaling target cofilin.PMID:25108566
We examine and compare the contribution of endoplasmic reticulum stress to retinal degeneration in several vertebrate models of retinitis pigementosa generated through expression of mutant rhodopsins.PMID:24664747
Rho kinase is involved in endothelial dysfunction in type 1 diabetes.PMID:24129169
The aim of this study was to examine the onset of Unfolded Protein Response (UPR) gene expression in S334ter Rho retinas to determine if UPR is activated in autosomal dominant retinitis pigmentosa animal models.PMID:22432009
Strong activation of calpain and poly(ADP-ribose) polymerase (PARP) was found in rhodopsin mutants.PMID:21765948
Phosphorylation of rhodopsin during dark adaptation in an animal model of retinitis pigmentosa.PMID:12965217
rats homozygous for P23H rhodopsin mutations have severe loss of rod function already seen by postnatal day 21PMID:15911114
Insulin receptor phosphorylation in rod photoreceptors is signaled through the G-protein-coupled receptor rhodopsin.PMID:17272282
Experiments with dissociated hippocampal cells show that the main factor limiting the spatial resolution is Rhodopsin current density rather than scattering of the excitation light.PMID:18654856