Recombinant Rat Rhodopsin (Rho)

Code: CSB-CF019681RA
Size:
20μg
20μg100μg
US$5098
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Rho
Uniprot NO.
Alternative Names
Rho; Rhodopsin
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-348
Target Protein Sequence
MNGTEGPNFYVPFSNITGVVRSPFEQPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG GEIGLWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP EGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVIFFLICWLPYASVAMYIFTHQGSNFGPIFMTLPAFFAKTASI YNPIIYIMMNKQFRNCMLTSLCCGKNPLGDDEASATASKTETSQVAPA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling.
Gene References into Functions
  1. these results suggest that retinoid metabolism in the eye is impaired in type 1 diabetes, which leads to deficient generation of visual pigments and neural retinal dysfunction in early diabetes. PMID:28734946
  2. EGF induces Ca(2+) sensitization in vascular smooth muscle by Rho-kinase-dependent inactivation of MLCP mediated by the EGF receptor/MEK/Erk1/2 pathway PMID:26004531
  3. Allele-specific ASO-mediated knockdown of mutant P23H rhodopsin expression slowed the rate of photoreceptor degeneration and preserved the function of photoreceptor cells in eyes of the P23H rhodopsin transgenic rat. PMID:26436889
  4. Phosphorylation of the Rho/ROCK signaling target cofilin. PMID:25108566
  5. We examine and compare the contribution of endoplasmic reticulum stress to retinal degeneration in several vertebrate models of retinitis pigementosa generated through expression of mutant rhodopsins. PMID:24664747
  6. Rho kinase is involved in endothelial dysfunction in type 1 diabetes. PMID:24129169
  7. The aim of this study was to examine the onset of Unfolded Protein Response (UPR) gene expression in S334ter Rho retinas to determine if UPR is activated in autosomal dominant retinitis pigmentosa animal models. PMID:22432009
  8. Strong activation of calpain and poly(ADP-ribose) polymerase (PARP) was found in rhodopsin mutants. PMID:21765948
  9. Phosphorylation of rhodopsin during dark adaptation in an animal model of retinitis pigmentosa. PMID:12965217
  10. rats homozygous for P23H rhodopsin mutations have severe loss of rod function already seen by postnatal day 21 PMID:15911114
  11. Insulin receptor phosphorylation in rod photoreceptors is signaled through the G-protein-coupled receptor rhodopsin. PMID:17272282
  12. Experiments with dissociated hippocampal cells show that the main factor limiting the spatial resolution is Rhodopsin current density rather than scattering of the excitation light. PMID:18654856

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products