Home
Product
Protein
Transmembrane Proteins
Recombinant Rat Prostaglandin D2 receptor 2 (Ptgdr2)

Recombinant Rat Prostaglandin D2 receptor 2 (Ptgdr2)

Code: CSB-CF744318RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5510

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Ptgdr2

Uniprot NO.

Q6XKD3

Alternative Names

Ptgdr2; Crth2; Gpr44; Prostaglandin D2 receptor 2; G protein-coupled receptor 44

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-403

Target Protein Sequence

MANITLKPLCPLLEEMVQLPNHSNSSLRYIDHVSVLLHGLASLLGLVENGLILFVVGCRM RQTVVTTWVLHLALSDLLAAASLPFFTYFLAVGHSWELGTTFCKLHSSVFFLNMFASGFL LSAISLDRCLQVVRPVWAQNHRTVAAAHRVCLMLWALAVLNTVPYFVFRDTIPRRDGRIM CYYNMLLLNPGSDRDTTCDYRQKALAVSKFLLAFMVPLAIIASSHVAVSLQLHHRGRQRT GRFVRLVAAIVVAFILCWGPYHIFSLLEARAHSVTTLRQLASRGLPFVTSLAFFNSVVNP LLYVLTCPDMLHKLRRSLLTVLESVLVEDSDLSTGPGKRCRRRHRRRASSTTTPASTLLL ADRFPQLRPARLIGWMRRGSAELPRRVREQSQEKQGSLSCTLD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for prostaglandin D2 (PGD2). Coupled to the G(i)-protein. Receptor activation may result in pertussis toxin-sensitive decreases in cAMP levels and Ca(2+) mobilization. PI3K signaling is also implicated in mediating PTGDR2 effects. PGD2 induced receptor internalization. CRTH2 internalization can be regulated by diverse kinases such as, PKC, PKA, GRK2, GPRK5/GRK5 and GRK6. Receptor activation is responsible, at least in part, in immune regulation and allergic/inflammation responses.

Gene References into Functions

CRTh2 mediates most prostaglandin D2 pro-inflammatory effects and long receptor residence time of antagonist LAS191859 translates into long-lasting in vivo efficacy. PMID:27317944
Production of prostaglandin D2 followed by eosinophil recruitment into the airways via a CRTH2 receptor are the major pathogenic factors responsible for the A. fumigatus-induced enhancement of airway inflammation and responsiveness. PMID:24329550
We believe that PGD2 signaling via DP2 signaling pathway from microglia to neurons is one of the triggering factors for mechanical allodynia in this neuropathic pain model. PMID:23505121

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Database Links

UNIGENE: Rn.198542

KEGG: rno:309212

STRING: 10116.ENSRNOP00000066082

Promotions