Recombinant Rat Proheparin-binding EGF-like growth factor (Hbegf)

Code: CSB-CF010154RA
Size:
20μg
20μg100μg
US$3879
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Hbegf
Uniprot NO.
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
24-208
Target Protein Sequence
ESLERLRRGLAAATSNPDPPTGTTNQLLPTGADRAQEVQDLEGTDLDLFKVAFSSKPQALATPGKEKNGKKKRKGKGLGKKRDPCLKKYKDYCIHGECRYLKELRIPSCHCLPGYHGQRCHGLTLPVENPLYTYDHTTVLAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDLESEEKVKLGMASSH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor.
Gene References into Functions
  1. Heterotrimeric G proteins directly regulate membrane-localized MMP14/MT1-MMP, resulting in HB-EGF release and EGFR transactivation. PMID:25759388
  2. HB-EGF promotes hepatic stellate cell proliferation via activation of the EGFR and ErbB4 receptors PMID:24303948
  3. FAK phosphorylation and FAK-mediated signal transduction play essential roles in HB-EGF-mediated intestinal epithelial cell migration and adhesion. PMID:24703506
  4. Intraluminal administration of HB-EGF reduces the severity of intestinal congestion/repurfusion(C/R) injury in rats. PMID:23534509
  5. HB-EGF induces cardiomyocyte hypertrophy through an EGFR-ERK5-MEF2A-COX-2 pathway. PMID:21244855
  6. There were no significant changes in HB-EGF mRNA or protein expression in either the plantaris or the soleus in response to functional overload. PMID:20696782
  7. HB-EGF contributes to vascular remodeling. PMID:11882602
  8. HB-EGF expressed in proximity to developing mesencephalic dopaminergic neurons promotes their survival in vitro. HB-EGF may be an important molecule for developing dopaminergic neurons of the ventral midbrain. PMID:11956950
  9. data indicate HB-EGF gene expression can be regulated by Cdx2 in intestinal epithelial (IEC-6) cells PMID:12223343
  10. Data suggest that the interaction between HB-EGF and EGFR transactivation is closely related to the proliferation of cardiac fibroblasts and cardiac remodeling after myocardial infarction. PMID:12237129
  11. HB-EGF mRNA expression and protein production in intestine undergoing ischemia/reperfusion injury PMID:12746188
  12. Chelerythrine stimulated production of reactive oxygen species, and antioxidants prevented chelerythrine-induced HB-EGF shedding, suggesting that the production of intracellular peroxides is necessary for this event PMID:15490481
  13. analysis of clearance of HB-EGF in adult and newborn rats PMID:16364500
  14. 5-HT2A receptor induces ERK phosphorylation and proliferation through TACE enzyme activation and HB-EGF shedding in mesangial cells PMID:16737974
  15. extracellular superoxide dismutase is related to the epidermal growth factor (EGF) signaling in two ways, competition for HSPG with heparin-binding-EGF and as an ROS scavenger PMID:16753836
  16. It is suggested that the increased expression of HB-EGF and the inhibition of glial cell swelling may be parts of a protective role of HB-EGF in the ischemic retina. PMID:16806064
  17. Juxtacrine activation of EGFR by membrane-anchored HB-EGF may play an important role in the regulation of tight junction proteins and transepithelial resistance. PMID:17855771
  18. Collectively, these data demonstrate that membrane-anchored HB-EGF is targeted to the inner nuclear membrane via a retrograde membrane trafficking pathway. PMID:18299347
  19. Pro-inflammatory stimuli induce the release of HB-EGF from mesenchyme cells, which stimulates DNA-replication in initiated/premalignant hepatocytes PMID:18929421
  20. rapid HA accumulation after epidermal wounding occurs through a mechanism requiring cleavage of HB-EGF and activation of EGFR signaling. PMID:19225541
  21. mechanical stretch promotes fetal type II cell differentiation via ectodomain shedding of HB-EGF and TGF-alpha PMID:19237431
  22. Hbegf is a potent dilator of terminal mesenteric arterioles. PMID:19389413

Show More

Hide All

Subcellular Location
[Heparin-binding EGF-like growth factor]: Secreted, extracellular space. Note=Mature HB-EGF is released into the extracellular space and probably binds to a receptor.; [Proheparin-binding EGF-like growth factor]: Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Most abundant in skeletal muscle, lung, spleen brain and heart.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products