Recombinant Rat Pre T-cell antigen receptor alpha (Ptcra)

Code: CSB-CF018961RA
Size:
20μg
20μg100μg
US$3864
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Ptcra
Uniprot NO.
Alternative Names
Ptcra; Pre T-cell antigen receptor alpha; pT-alpha; pTa; pT-alpha-TCR
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
17-199
Target Protein Sequence
LPSGIAGTPFPSLAPPVTLLVDGRRHTLVVCLVLDAAPPGLDSLVWFSGGNGSALDAFTYGPSPAPDGTWTSLGQLSLSSEELEAWEPLVCHTRPAAGGLNRSTHPLQLSGEEASTDRTCPQETLRGTQRQVLRLSVLRLLLFKLLLLDVFLTCSRLCVLAGQHLLPPPSSKQAPASTHQSWT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
The pre-T-cell receptor complex (composed of PTCRA, TCRB and the CD3 complex) regulates early T-cell development.
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Found in CD45+ but not in the CD45- fetal liver cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products